DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and tpm2

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001025587.1 Gene:tpm2 / 594975 XenbaseID:XB-GENE-6071381 Length:284 Species:Xenopus tropicalis


Alignment Length:281 Identity:122/281 - (43%)
Similarity:185/281 - (65%) Gaps:0/281 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTAKEQLE 65
            |||||||||.:||:|:||||:|:..|...|.|..|..::.|||..|:||....|.::....|.::
 Frog     1 MDAIKKKMQMLKLDKENAIDRAEQAEGDKKQAEDRCKQIEEEVMALQKKTKSTEDEVEKYSESVK 65

  Fly    66 KANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSADENNRMCKVL 130
            :|..:||..||..|..|:|||:.||::|.:||:|::::||..||.|||.|..::.||:.|..||:
 Frog    66 EAQEKLEMAEKKATDAEAEVASLNRRIQLVEEELDRAQERLATALQKLEETEKAVDESERGMKVI 130

  Fly   131 ENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEE 195
            |||:.:|||:|.....||:||:.:||::|.|.:||:|||..:|.:||.:|:|....||::.:|||
 Frog   131 ENRATKDEEKMVDQEQQLREAKNIAEESDRKYEEVARKLVVLEGDLERSEERAEVAESRLRQLEE 195

  Fly   196 ELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVKRLQKEVDRLEDEL 260
            ||:.:..:||||..:||:...:.::::.|:|.||.||||.:.|.|.|||.|.:|:|.:|.||:.|
 Frog   196 ELRTMDQNLKSLIAAEEEYASKEDKYEDEIKLLSEKLKETDGRVEFAEKSVVKLEKTIDDLEENL 260

  Fly   261 GINKDRYKSLADEMDSTFAEL 281
            ...|:....|...:|.|..||
 Frog   261 SAAKEESIELNQTLDQTLLEL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 95/232 (41%)
tpm2NP_001025587.1 Tropomyosin 48..282 CDD:365985 97/234 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 1 1.000 - - FOG0002679
OrthoInspector 1 1.000 - - mtm9336
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.