DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and Tpm3

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001280677.2 Gene:Tpm3 / 59069 MGIID:1890149 Length:285 Species:Mus musculus


Alignment Length:281 Identity:132/281 - (46%)
Similarity:195/281 - (69%) Gaps:0/281 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTAKEQLE 65
            |:|||||||.:||:|:|.:|:|:..|.:.|.|..|:.:|.:|:..::||....|.:|....|.|:
Mouse     2 MEAIKKKMQMLKLDKENVLDRAEQAEAEQKQAEERSKQLEDELATMQKKLKGTEDELDKYSEALK 66

  Fly    66 KANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSADENNRMCKVL 130
            .|..:||..||.....|:|||:.||::|.:||:|::::||..||.|||.||.::|||:.|..||:
Mouse    67 DAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI 131

  Fly   131 ENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEE 195
            |||:.:|||:|:....|||||:.:||:||.|.:||:|||..:|.:||..|:|....|||..||||
Mouse   132 ENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEE 196

  Fly   196 ELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVKRLQKEVDRLEDEL 260
            |||.|.|:|||||...||.:|:.::::.|:|.|:.||||||.|||.||:.|.:|:|.:|.|||||
Mouse   197 ELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDEL 261

  Fly   261 GINKDRYKSLADEMDSTFAEL 281
            ...|.:||:::||:|....::
Mouse   262 YAQKLKYKAISDELDHALNDM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 112/232 (48%)
Tpm3NP_001280677.2 CLZ 14..73 CDD:406832 18/58 (31%)
Tropomyosin 49..283 CDD:395200 112/234 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837808
Domainoid 1 1.000 248 1.000 Domainoid score I2128
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48449
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002679
OrthoInspector 1 1.000 - - mtm8688
orthoMCL 1 0.900 - - OOG6_101961
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.710

Return to query results.
Submit another query.