DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and tpm1

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_031753701.1 Gene:tpm1 / 448541 XenbaseID:XB-GENE-485946 Length:326 Species:Xenopus tropicalis


Alignment Length:323 Identity:134/323 - (41%)
Similarity:196/323 - (60%) Gaps:42/323 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKK--------------FV 51
            |||||||||.:||:|:||:|:|:..|...|.|..::.:|.||:..|||:              |.
 Frog     1 MDAIKKKMQMLKLDKENALDRAEQAEADKKGAEEKSKQLEEEIAQLEKQLRVTEDTRDKIMDDFH 65

  Fly    52 QVEIDLVTAKEQ----------------------------LEKANTELEEKEKLLTATESEVATQ 88
            ..|..|:.|:|:                            |:.|..:||..||..|..|.:||:.
 Frog    66 HAEESLLAAEEKATKLEDELVALQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEGDVASL 130

  Fly    89 NRKVQQIEEDLEKSEERSTTAQQKLLEATQSADENNRMCKVLENRSQQDEERMDQLTNQLKEARM 153
            ||::|.:||:|::::||..||.|||.||.::|||:.|..||:|||:.:|||:|:....|||||:.
 Frog   131 NRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKH 195

  Fly   154 LAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRV 218
            :||:||.|.:||:|||..:|.:||.||:|....|||..|||||||.|.|:|||||...||.:|:.
 Frog   196 IAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKE 260

  Fly   219 EEFKREMKTLSIKLKEAEQRAEHAEKQVKRLQKEVDRLEDELGINKDRYKSLADEMDSTFAEL 281
            ::::.|:|.|:.||||||.|||.||:.|.:|:|.:|.||:::...|:...::...:|.|..||
 Frog   261 DKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEEKVTHAKEENLNMHQMLDQTLLEL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 108/274 (39%)
tpm1XP_031753701.1 PRK12704 1..>154 CDD:237177 50/152 (33%)
Tropomyosin 90..324 CDD:395200 104/234 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9336
Panther 1 1.100 - - O PTHR19269
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.