DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and Tm1

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster


Alignment Length:294 Identity:149/294 - (50%)
Similarity:190/294 - (64%) Gaps:41/294 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DNAIDKADTCENQAKD-----ANSRADKL--NEEVR---------------------DLEKKFVQ 52
            |..|..||..:|||.:     ..|.|.::  ..|.|                     |...||..
  Fly   427 DEGIALADDDDNQAAEWSKLRCTSEAAEIVAEREARRNKGRCADYPGLAFGRSIFSSDTMMKFNI 491

  Fly    53 VEIDLVTAKEQLEKANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEAT 117
            :..:|...      .||:|:.       .|||||..||::|.:|||||:||||..:|..||.||:
  Fly   492 IRNELHNI------MNTQLKR-------AESEVAALNRRIQLLEEDLERSEERLGSATAKLSEAS 543

  Fly   118 QSADENNRMCKVLENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDR 182
            |:|||:.|..|:||||:..||||||.|.|||||||.|||:||.|.|||:||||.||.:||.||:|
  Fly   544 QAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEER 608

  Fly   183 VRSGESKIMELEEELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVK 247
            ...||:||:||||||:||||:||||||||||||||.||:|.::|||:.:|||||.|||.||:.|:
  Fly   609 AEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQ 673

  Fly   248 RLQKEVDRLEDELGINKDRYKSLADEMDSTFAEL 281
            :||||||||||:|.:.|:|||.:.|::|:.|.||
  Fly   674 KLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 135/232 (58%)
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 89/130 (68%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449910
Domainoid 1 1.000 245 1.000 Domainoid score I2136
eggNOG 1 0.900 - - E1_KOG1003
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 1 1.000 - - FOG0002679
OrthoInspector 1 1.000 - - mtm6508
orthoMCL 1 0.900 - - OOG6_101961
Panther 1 1.100 - - P PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
109.750

Return to query results.
Submit another query.