DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and cdc8

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_594530.1 Gene:cdc8 / 2541940 PomBaseID:SPAC27F1.02c Length:161 Species:Schizosaccharomyces pombe


Alignment Length:158 Identity:45/158 - (28%)
Similarity:81/158 - (51%) Gaps:17/158 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 MDQLTNQLKEAR-------MLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEEELK 198
            ||:|..::..||       ..||.|:.|..||..:|:..|.|.|....:..:.||::.|||||.|
pombe     1 MDKLREKINAARAETDEAVARAEAAEAKLKEVELQLSLKEQEYESLSRKSEAAESQLEELEEETK 65

  Fly   199 VVGNSLKSLEVSEEKANQ---RVEEFKREMKT-------LSIKLKEAEQRAEHAEKQVKRLQKEV 253
            .:.....:.::.:.:|.|   :||..:.|::|       .:.|:::.:.:|||.|::|:.|::|.
pombe    66 QLRLKADNEDIQKTEAEQLSRKVELLEEELETNDKLLRETTEKMRQTDVKAEHFERRVQSLERER 130

  Fly   254 DRLEDELGINKDRYKSLADEMDSTFAEL 281
            |.:|.:|....|:|..:..|:|.....|
pombe   131 DDMEQKLEEMTDKYTKVKAELDEVHQAL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 44/156 (28%)
cdc8NP_594530.1 Tropomyosin_1 7..148 CDD:289488 39/140 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19269
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.