DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and Tpm4

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_036810.1 Gene:Tpm4 / 24852 RGDID:3899 Length:248 Species:Rattus norvegicus


Alignment Length:281 Identity:114/281 - (40%)
Similarity:167/281 - (59%) Gaps:42/281 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTAKEQLE 65
            ::|:|:|:||:              :.||.||..||..|..|:                      
  Rat     7 LEAVKRKIQAL--------------QQQADDAEDRAQGLQREL---------------------- 35

  Fly    66 KANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSADENNRMCKVL 130
              :.|.|.:||    .|.:.|..||::|.:||:|::::||..||.|||.||.::|||:.|..||:
  Rat    36 --DGERERREK----AEGDAAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVI 94

  Fly   131 ENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEE 195
            |||:.:|||:|:....|||||:.:||:||.|.:||:|||..:|.|||.||:|....|.|..:|||
  Rat    95 ENRAMKDEEKMEIQEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKSSDLEE 159

  Fly   196 ELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVKRLQKEVDRLEDEL 260
            |||.|.|:|||||.:.||.:::.::::.|:|.||.||||||.|||.||:.|.:|:|.:|.||::|
  Rat   160 ELKNVTNNLKSLEAASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVSKLEKTIDDLEEKL 224

  Fly   261 GINKDRYKSLADEMDSTFAEL 281
            ...|:....|...:|.|..||
  Rat   225 AQAKEENVGLHQTLDQTLNEL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 99/232 (43%)
Tpm4NP_036810.1 Tropomyosin 12..246 CDD:395200 112/276 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..49 13/58 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341554
Domainoid 1 1.000 245 1.000 Domainoid score I2112
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48449
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8925
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X463
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.820

Return to query results.
Submit another query.