DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and Y45F10B.9

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_502624.1 Gene:Y45F10B.9 / 189919 WormBaseID:WBGene00012873 Length:244 Species:Caenorhabditis elegans


Alignment Length:176 Identity:34/176 - (19%)
Similarity:78/176 - (44%) Gaps:21/176 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 ENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTAKEQLEKANTELEEKEKLLTATESEVATQ-- 88
            :|.||......|.::...:..||.|..:::|::....:.:.|..|::..::.|  ...::.||  
 Worm    20 QNMAKLKRELEDHIDMPEQKAEKFFENLQLDIMIMAAEKDIATDEVDSVKQAL--MNQQMITQHL 82

  Fly    89 -------------NRKVQQIEEDLEKSEERSTTAQQKLLEATQSADENNRMCKVLENRSQ-QDEE 139
                         |.:::.::|:|:|.|.:.:..::.|:::.....|.:...|.:....: .|:|
 Worm    83 KKRNEYLDDLEEANERIKILDEELDKLEAKISKTEESLVQSVSMLLEKDEQLKTIRKEMKIMDDE 147

  Fly   140 R--MDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRV 183
            |  .||...:||.:| |..:..:.:..|...:.::..:.|....||
 Worm   148 RSAFDQELTRLKTSR-LENEKSSLASRVECTICYLSYDNEARVPRV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 29/154 (19%)
Y45F10B.9NP_502624.1 Smc 20..>175 CDD:224117 30/157 (19%)
RING_Ubox 175..221 CDD:388418 3/18 (17%)
RING-HC finger (C3HC4-type) 176..220 CDD:319361 3/17 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.959148 Normalized mean entropy S1426
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.