DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm2 and lev-11

DIOPT Version :9

Sequence 1:NP_001262592.1 Gene:Tm2 / 41853 FlyBaseID:FBgn0004117 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001021695.1 Gene:lev-11 / 173319 WormBaseID:WBGene00002978 Length:284 Species:Caenorhabditis elegans


Alignment Length:284 Identity:163/284 - (57%)
Similarity:222/284 - (78%) Gaps:0/284 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDAIKKKMQAMKLEKDNAIDKADTCENQAKDANSRADKLNEEVRDLEKKFVQVEIDLVTAKEQLE 65
            ||||||||||||:|||||:|:||..|.:.:....:.:::.||:||.:||..|...||..|:|.|.
 Worm     1 MDAIKKKMQAMKIEKDNALDRADAAEEKVRQITEKLERVEEELRDTQKKMTQTGDDLDKAQEDLS 65

  Fly    66 KANTELEEKEKLLTATESEVATQNRKVQQIEEDLEKSEERSTTAQQKLLEATQSADENNRMCKVL 130
            .|.::||||||.:...|:|||:.||::..:||:||::|||...|.:||.|||.:.||:.|:.||:
 Worm    66 AATSKLEEKEKTVQEAEAEVASLNRRMTLLEEELERAEERLKIATEKLEEATHNVDESERVRKVM 130

  Fly   131 ENRSQQDEERMDQLTNQLKEARMLAEDADTKSDEVSRKLAFVEDELEVAEDRVRSGESKIMELEE 195
            ||||.|||||.:.:..|||||::|||:||.|.|||:||||.||.:||.||:|..:||:||:||||
 Worm   131 ENRSLQDEERANTVEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEE 195

  Fly   196 ELKVVGNSLKSLEVSEEKANQRVEEFKREMKTLSIKLKEAEQRAEHAEKQVKRLQKEVDRLEDEL 260
            ||:||||:|||||||||||.||.:.::.:::|:|.:|||||.|||.||:.|::||||||||||||
 Worm   196 ELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDEL 260

  Fly   261 GINKDRYKSLADEMDSTFAELAGY 284
            ...|:|||::::|:||||.||:||
 Worm   261 VHEKERYKTISEELDSTFQELSGY 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm2NP_001262592.1 Tropomyosin 48..281 CDD:395200 134/232 (58%)
lev-11NP_001021695.1 Tropomyosin 48..282 CDD:278679 135/233 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159707
Domainoid 1 1.000 59 1.000 Domainoid score I7069
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.959148 Normalized mean entropy S1426
OMA 1 1.010 - - QHG48449
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 1 1.000 - - FOG0002679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101961
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.