DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm1 and TPM1

DIOPT Version :9

Sequence 1:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_014320.1 Gene:TPM1 / 855645 SGDID:S000005023 Length:199 Species:Saccharomyces cerevisiae


Alignment Length:218 Identity:52/218 - (23%)
Similarity:101/218 - (46%) Gaps:49/218 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   492 IRNELHNI----------------MNTQLKR----AESEVAALNRRIQLLEEDLERSEERLGSAT 536
            ||.:|.|:                .|..|::    .|:::.:|..:.|.||:::|:.|  .|.:.
Yeast     4 IREKLSNLKLEAESWQEKYEELKEKNKDLEQENVEKENQIKSLTVKNQQLEDEIEKLE--AGLSD 66

  Fly   537 AKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEA---DKKYDEVARKLAMV 598
            :|.:|......|::.....::|..|  ||.::.||.:|.|::.|:|::   ....|..::|...:
Yeast    67 SKQTEQDNVEKENQIKSLTVKNHQL--EEEIEKLEAELAESKQLSEDSHHLQSNNDNFSKKNQQL 129

  Fly   599 EADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKA---NQREE-EYKNQIKTLNTRLK 659
            |.||       |:.:.|:.|..|:||  .::||:.::....|   .|||| |.||:         
Yeast   130 EEDL-------EESDTKLKETTEKLR--ESDLKADQLERRVAALEEQREEWERKNE--------- 176

  Fly   660 EAEARAEFAERSVQKLQKEVDRL 682
            |...:.|.|::.:.::...::.|
Yeast   177 ELTVKYEDAKKELDEIAASLENL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 38/137 (28%)
TPM1NP_014320.1 Tropomyosin_1 7..186 CDD:403808 48/200 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR19269
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.