DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm1 and GOLGA6L10

DIOPT Version :9

Sequence 1:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001309329.1 Gene:GOLGA6L10 / 647042 HGNCID:37228 Length:536 Species:Homo sapiens


Alignment Length:396 Identity:94/396 - (23%)
Similarity:157/396 - (39%) Gaps:81/396 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 PPAGTTTSKSKKKKREKGERSEKSDKSEKS-------DRKKKSSGKKERSKRSNPMEQSSDSLAT 419
            ||....:.|:::.|....::..|:....||       :||||.:|....:..|.......||   
Human     8 PPHPAMSEKTQQGKLAAAKKKLKAYWQRKSPGIPAGANRKKKVNGSSPDTATSGGYHSPGDS--- 69

  Fly   420 DLSAGAIDEGIALADDDDNQAAEWSKLRCTSEAAEIV-------------AEREARRNKGRCADY 471
              :.|...||.|.:....:..:::.:|....:::..:             ..:|.::::..... 
Human    70 --ATGIYGEGRASSTTLQDLESQYQELAVALDSSSAIISQLTENINSLVRTSKEEKKHEIHLVQ- 131

  Fly   472 PGLAFGRSIFS--------------------SDTMMKFNIIRNELHNIMNTQLKRAESE----VA 512
               ..|||:|.                    .....:.|.:|.||.:: ..|| :||.|    ::
Human   132 ---KLGRSLFKLKNQTAEPLAPEPPAGPSKVEQLQDETNHLRKELESV-GRQL-QAEVENNQMLS 191

  Fly   513 ALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEA 577
            .||||   .||.|...||||.....:|.|..:...|.|...:..|.|....|||:...|.:|:|.
Human   192 LLNRR---QEERLREQEERLHEQEERLHEQEERLCEQEERLREQEERLCEQEERLREQEERLREQ 253

  Fly   578 RFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQ 642
            .....|.:::..|...:|...|..|...|||..:.|.::.|.||.||          ..||:..:
Human   254 EERLREQEERLHEQEERLHEQEERLCEQEERLREQEERLCEQEERLR----------EQEERLCE 308

  Fly   643 REEEYKNQIKTL---NTRLKEAEARAEFAER--SVQKLQKEVDRL--------EDDLVLEKERYK 694
            :||..:.|.:.|   ..||.|.|.|....|:  ..::|.:||::|        |.:.:||:||..
Human   309 QEERLREQEERLCEQEERLCEQEERLCEQEKLPGQERLLEEVEKLLEQERRQEEQERLLERERLL 373

  Fly   695 DIGDDL 700
            |..::|
Human   374 DEVEEL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 38/130 (29%)
GOLGA6L10NP_001309329.1 GOLGA2L5 83..>219 CDD:291729 28/144 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.