DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm1 and Tpm3

DIOPT Version :9

Sequence 1:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001280677.2 Gene:Tpm3 / 59069 MGIID:1890149 Length:285 Species:Mus musculus


Alignment Length:336 Identity:149/336 - (44%)
Similarity:209/336 - (62%) Gaps:60/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 KKKKREKGERSEKSDKSEKSDRKKKSSGKKERSKRSNPMEQSSDSLATDLSAGAIDEGIALADDD 436
            ||.:..|.::....|::|:::.::|.:  :||||      |..|.|||      :.:.:...:|:
Mouse     7 KKMQMLKLDKENVLDRAEQAEAEQKQA--EERSK------QLEDELAT------MQKKLKGTEDE 57

  Fly   437 DNQAAEWSKLRCTSEAAEIVAEREARRNKGRCADYPGLAFGRSIFSSDTMMKFNIIRNELHNIMN 501
            .::.:|  .|:...|..|: ||::|       ||                               
Mouse    58 LDKYSE--ALKDAQEKLEL-AEKKA-------AD------------------------------- 81

  Fly   502 TQLKRAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEER 566
                 ||:|||:|||||||:||:|:|::|||.:|..||.||.:|||||||..|::|||||.|||:
Mouse    82 -----AEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEK 141

  Fly   567 MDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLK 631
            |:..|.|||||:.:|||||:||:||||||.::|.||||.|||||..|:|..||||||:.|.||||
Mouse   142 MELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLK 206

  Fly   632 SLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDI 696
            |||...||.:|:|::|:.:||.|..:|||||.|||||||||.||:|.:|.|||:|..:|.:||.|
Mouse   207 SLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAI 271

  Fly   697 GDDLDTAFVEL 707
            .|:||.|..::
Mouse   272 SDELDHALNDM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 82/130 (63%)
Tpm3NP_001280677.2 CLZ 14..73 CDD:406832 16/74 (22%)
Tropomyosin 49..283 CDD:395200 134/280 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837807
Domainoid 1 1.000 248 1.000 Domainoid score I2128
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 301 1.000 Inparanoid score I2662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002679
OrthoInspector 1 1.000 - - mtm8688
orthoMCL 1 0.900 - - OOG6_101961
Panther 1 1.100 - - LDO PTHR19269
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2857
SonicParanoid 1 1.000 - - X463
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.