DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm1 and tpm4

DIOPT Version :9

Sequence 1:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_012818712.1 Gene:tpm4 / 549841 XenbaseID:XB-GENE-6077097 Length:284 Species:Xenopus tropicalis


Alignment Length:336 Identity:140/336 - (41%)
Similarity:193/336 - (57%) Gaps:60/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 KKKKREKGERSEKSDKSEKSDRKKKSSGKKERSKRSNPMEQSSDSLATDLSAGAIDEGIALADDD 436
            ||.:..|.::....|::|:::..||::..|        .:|..|.|.      |:.:.:...:|:
 Frog     6 KKMQMLKLDKENAIDRAEQAEADKKAAEDK--------CKQVEDELV------ALQKKLKGTEDE 56

  Fly   437 DNQAAEWSKLRCTSEAAEIVAEREARRNKGRCADYPGLAFGRSIFSSDTMMKFNIIRNELHNIMN 501
                     |...|||.:...|:..:.:| :..|                               
 Frog    57 ---------LDKYSEALKDAQEKLEQADK-KATD------------------------------- 80

  Fly   502 TQLKRAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEER 566
                 ||.|||||||||||:||:|:|::|||.:|..||.||.:|||||||..|::||||:.|||:
 Frog    81 -----AEGEVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK 140

  Fly   567 MDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLK 631
            |:..|.|||||:.:|||||:||:||||||.::|.:|||||||||..|.|..:|||||:.|.||||
 Frog   141 MEIQELQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCSDLEEELKNVTNNLK 205

  Fly   632 SLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDI 696
            |||...||.:::|::|:.:||.|..:|||||.|||||||||.||:|.:|.|||.|...||....:
 Frog   206 SLEAQSEKYSEKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLATAKEENLGM 270

  Fly   697 GDDLDTAFVEL 707
            ...||....||
 Frog   271 HQVLDQTLQEL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 79/130 (61%)
tpm4XP_012818712.1 Tropomyosin 48..281 CDD:365985 126/278 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2136
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I2687
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9336
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.