DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm1 and tpm1

DIOPT Version :9

Sequence 1:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_031753701.1 Gene:tpm1 / 448541 XenbaseID:XB-GENE-485946 Length:326 Species:Xenopus tropicalis


Alignment Length:347 Identity:147/347 - (42%)
Similarity:213/347 - (61%) Gaps:40/347 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 KKKKREKGERSEKSDKSEKSDRKKKSSGKKERSKRSNPMEQSSDSLATDLSAGAIDEGIALADD- 435
            ||.:..|.::....|::|:::..||  |.:|:||      |..:.:|      .:::.:.:.:| 
 Frog     6 KKMQMLKLDKENALDRAEQAEADKK--GAEEKSK------QLEEEIA------QLEKQLRVTEDT 56

  Fly   436 -----DDNQAAEWSKLRCTSEAAEIVAEREA--RRNKGRCADYPGLAFGRSIFSSDTMMKFNIIR 493
                 ||...||.|.|....:|.::..|..|  ::.||               :.|.:.|::...
 Frog    57 RDKIMDDFHHAEESLLAAEEKATKLEDELVALQKKLKG---------------TEDELDKYSEAL 106

  Fly   494 NELHNIMNTQLKR---AESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKI 555
            .:....:....|:   ||.:||:|||||||:||:|:|::|||.:|..||.||.:|||||||..|:
 Frog   107 KDAQEKLELAEKKATDAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKV 171

  Fly   556 LENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELE 620
            :|||||.|||:|:..|.|||||:.:|||||:||:||||||.::|.||||||||||..|:|..|||
 Frog   172 IENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELE 236

  Fly   621 EELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDD 685
            |||:.|.|||||||...||.:|:|::|:.:||.|..:|||||.|||||||:|.||:|.:|.||:.
 Frog   237 EELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEEK 301

  Fly   686 LVLEKERYKDIGDDLDTAFVEL 707
            :...||...::...||...:||
 Frog   302 VTHAKEENLNMHQMLDQTLLEL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 83/130 (64%)
tpm1XP_031753701.1 PRK12704 1..>154 CDD:237177 47/176 (27%)
Tropomyosin 90..324 CDD:395200 124/249 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I2687
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9336
Panther 1 1.100 - - O PTHR19269
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2857
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.190

Return to query results.
Submit another query.