DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm1 and MGC76092

DIOPT Version :9

Sequence 1:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster
Sequence 2:XP_031746146.1 Gene:MGC76092 / 394917 -ID:- Length:271 Species:Xenopus tropicalis


Alignment Length:201 Identity:114/201 - (56%)
Similarity:160/201 - (79%) Gaps:0/201 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 AESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALE 571
            ||:|||:|||||||:||:|:|::|||.:|..||.||.:.||||||..|::|||||.|||:|:..|
 Frog    47 AEAEVASLNRRIQLVEEELDRAQERLSTALQKLEEAEKTADESERGMKVIENRALKDEEKMELQE 111

  Fly   572 NQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVS 636
            .|||||:.:|||||:||:||||||.::|.||||.|||||..|::..:|||::|::.::||.|..:
 Frog   112 IQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESRCRDLEEQIRMLDHSLKCLNAT 176

  Fly   637 EEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLD 701
            |||.:::|::|:.:||.|..:|||||.|||||||||.||:|.:|.|||:|..:|.:||.|.::||
 Frog   177 EEKYSKKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELD 241

  Fly   702 TAFVEL 707
            .|..::
 Frog   242 HALNDM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 73/130 (56%)
MGC76092XP_031746146.1 Tropomyosin 14..248 CDD:395200 114/201 (57%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9336
Panther 1 1.100 - - LDO PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.020

Return to query results.
Submit another query.