DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm1 and Pnn

DIOPT Version :9

Sequence 1:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001102493.1 Gene:Pnn / 368070 RGDID:1597086 Length:729 Species:Rattus norvegicus


Alignment Length:411 Identity:90/411 - (21%)
Similarity:154/411 - (37%) Gaps:111/411 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 DEGASNPAAALIAEDAAPPAGTTTSKSKKKKREKGERSEKSDKSEKSDRKKKS--SGKKERSKRS 407
            |.|...||.....|.|....|    ..::.:||..:.|:..|...|....:.|  :..|||::|.
  Rat    67 DSGGGPPAKQRDLEGAVSRLG----GERRTRRESRQESDPEDDDVKKPALQSSVVATSKERTRRD 127

  Fly   408 NPMEQSSDSLATDLSA---GAIDEGIALADDDDNQAAEWSKLRCTSE-AAEIVAEREARRNKGRC 468
            ...:|:.|......:.   |.:...:.....:...|.|..|.|...| ..|:.||.|.::     
  Rat   128 LIQDQNMDEKGKQRNRRIFGLLMGTLQKFKQESTVATERQKRRQEIEQKLEVQAEEERKQ----- 187

  Fly   469 ADYPGLAFGRSIFSSDTMMKFNIIRNELHNIMNTQLKRAESEVAALNRRIQLLEEDLERSEE--- 530
                                   :.||...:.. :.:..::|:..|.::::|.:...|.:|.   
  Rat   188 -----------------------VENERRELFE-ERRAKQTELRLLEQKVELAQLQEEWNEHNAK 228

  Fly   531 ------------------RLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEA 577
                              |:..||.||.|.||     .:...:.|.|.:...|:::.:     ||
  Rat   229 IIKYIRTKTKPHLFYIPGRMCPATQKLIEESQ-----RKMNALFEGRRIEFAEQINKM-----EA 283

  Fly   578 RFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEV------- 635
            |...:...:|..:|.|          ..|::|||.|.|:.:.||||...||....:|:       
  Rat   284 RPRRQSMKEKEHQVVR----------NEEQKAEQEEGKVAQREEELEETGNQHNDVEIEEAGEEE 338

  Fly   636 -------SEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDL--VLEK- 690
                   |:.:.:|.|||.|          :|.|||.| .|..|::.:|:.|...:::  |||. 
  Rat   339 KEAGVVHSDAEKDQEEEEQK----------QETEARME-EETGVREGEKQQDSQPEEVMDVLEMV 392

  Fly   691 ERYKDI---GDDLDTAFVELI 708
            |..|::   .:.::|..||.|
  Rat   393 ESVKNVIAEQEVMETNQVESI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 38/165 (23%)
PnnNP_001102493.1 Pinin_SDK_N 5..132 CDD:282542 17/68 (25%)
Pinin_SDK_memA 136..261 CDD:282541 25/158 (16%)
FAM75 <491..>537 CDD:291323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.