DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm1 and Tpm4

DIOPT Version :9

Sequence 1:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_036810.1 Gene:Tpm4 / 24852 RGDID:3899 Length:248 Species:Rattus norvegicus


Alignment Length:203 Identity:116/203 - (57%)
Similarity:155/203 - (76%) Gaps:0/203 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   505 KRAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDA 569
            ::||.:.|||||||||:||:|:|::|||.:|..||.||.:|||||||..|::||||:.|||:|:.
  Rat    43 EKAEGDAAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEKMEI 107

  Fly   570 LENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLE 634
            .|.|||||:.:|||||:||:||||||.::|.:|||||||||..|.|..:|||||:.|.|||||||
  Rat   108 QEMQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKSSDLEEELKNVTNNLKSLE 172

  Fly   635 VSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDD 699
            .:.||.:::|::|:.:||.|:.:|||||.|||||||:|.||:|.:|.||:.|...||....:...
  Rat   173 AASEKYSEKEDKYEEEIKLLSDKLKEAETRAEFAERTVSKLEKTIDDLEEKLAQAKEENVGLHQT 237

  Fly   700 LDTAFVEL 707
            ||....||
  Rat   238 LDQTLNEL 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 79/130 (61%)
Tpm4NP_036810.1 Tropomyosin 12..246 CDD:395200 116/203 (57%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..49 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341553
Domainoid 1 1.000 245 1.000 Domainoid score I2112
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 299 1.000 Inparanoid score I2620
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8925
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X463
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.860

Return to query results.
Submit another query.