DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm1 and Tpm2

DIOPT Version :9

Sequence 1:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001264804.1 Gene:Tpm2 / 22004 MGIID:98810 Length:284 Species:Mus musculus


Alignment Length:336 Identity:135/336 - (40%)
Similarity:196/336 - (58%) Gaps:60/336 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 KKKREKGERSEKSDKSEKSDRKKKS-SGKKERSKRSNPMEQSSDSLATDLSAGAIDEGIALADDD 436
            |||.:    ..|.||....||.::: :.||:...|...:|:...:|...|..         .:|:
Mouse     5 KKKMQ----MLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKG---------TEDE 56

  Fly   437 DNQAAEWSKLRCTSEAAEIVAEREARRNKGRCADYPGLAFGRSIFSSDTMMKFNIIRNELHNIMN 501
            ..:.:|..|     :|.|.:.:.|.:                   ::|                 
Mouse    57 VEKYSESVK-----DAQEKLEQAEKK-------------------ATD----------------- 80

  Fly   502 TQLKRAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEER 566
                 ||::||:|||||||:||:|:|::|||.:|..||.||.:|||||||..|::||||:.|||:
Mouse    81 -----AEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRAMKDEEK 140

  Fly   567 MDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLK 631
            |:..|.|||||:.:||::|:||:||||||.::|.:|||:|||||..|:|..:|||||::|.||||
Mouse   141 MELQEMQLKEAKHIAEDSDRKYEEVARKLVILEGELERSEERAEVAESKCGDLEEELKIVTNNLK 205

  Fly   632 SLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDI 696
            |||...:|.:.:|::|:.:||.|..:|||||.|||||||||.||:|.:|.||:.|...||...:|
Mouse   206 SLEAQADKYSTKEDKYEEEIKLLEEKLKEAETRAEFAERSVAKLEKTIDDLEETLASAKEENVEI 270

  Fly   697 GDDLDTAFVEL 707
            ...||...:||
Mouse   271 HQTLDQTLLEL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 75/130 (58%)
Tpm2NP_001264804.1 Tropomyosin 48..282 CDD:395200 122/289 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837809
Domainoid 1 1.000 248 1.000 Domainoid score I2128
eggNOG 1 0.900 - - E1_KOG1003
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 301 1.000 Inparanoid score I2662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 1 1.000 - - FOG0002679
OrthoInspector 1 1.000 - - mtm8688
orthoMCL 1 0.900 - - OOG6_101961
Panther 1 1.100 - - O PTHR19269
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X463
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.760

Return to query results.
Submit another query.