DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tm1 and lev-11

DIOPT Version :9

Sequence 1:NP_732006.2 Gene:Tm1 / 41852 FlyBaseID:FBgn0003721 Length:711 Species:Drosophila melanogaster
Sequence 2:NP_001021695.1 Gene:lev-11 / 173319 WormBaseID:WBGene00002978 Length:284 Species:Caenorhabditis elegans


Alignment Length:295 Identity:176/295 - (59%)
Similarity:216/295 - (73%) Gaps:17/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   415 DSLATDLSAGAIDEGIALADDDDNQAAEWSKLRCTSEAAEIVAE--REARRNKGRCADYPGLAFG 477
            |::...:.|..|::..||   |...||| .|:|..:|..|.|.|  |:.::...:..|  .|...
 Worm     2 DAIKKKMQAMKIEKDNAL---DRADAAE-EKVRQITEKLERVEEELRDTQKKMTQTGD--DLDKA 60

  Fly   478 RSIFSSDTMMKFNIIRNELHNIMNTQLKRAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEA 542
            :...|:.|        ::|.....| ::.||:|||:||||:.||||:|||:||||..||.||.||
 Worm    61 QEDLSAAT--------SKLEEKEKT-VQEAEAEVASLNRRMTLLEEELERAEERLKIATEKLEEA 116

  Fly   543 SQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEE 607
            :...|||||.||::|||:|.||||.:.:|.|||||:.||||||:|||||||||||||||||||||
 Worm   117 THNVDESERVRKVMENRSLQDEERANTVEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEE 181

  Fly   608 RAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSV 672
            |||.|||||||||||||||||||||||||||||.|||:.|:.||:|:::||||||.|||||||||
 Worm   182 RAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSV 246

  Fly   673 QKLQKEVDRLEDDLVLEKERYKDIGDDLDTAFVEL 707
            ||||||||||||:||.||||||.|.::||:.|.||
 Worm   247 QKLQKEVDRLEDELVHEKERYKTISEELDSTFQEL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Tm1NP_732006.2 Tropomyosin_1 7..>85 CDD:289488
Tropomyosin_1 517..648 CDD:289488 101/130 (78%)
lev-11NP_001021695.1 Tropomyosin 48..282 CDD:278679 160/245 (65%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159706
Domainoid 1 1.000 308 1.000 Domainoid score I732
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H121635
Inparanoid 1 1.050 366 1.000 Inparanoid score I1255
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576041at2759
OrthoFinder 1 1.000 - - FOG0002679
OrthoInspector 1 1.000 - - oto17870
orthoMCL 1 0.900 - - OOG6_101961
Panther 1 1.100 - - LDO PTHR19269
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2857
SonicParanoid 1 1.000 - - X463
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1312.930

Return to query results.
Submit another query.