DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo43 and COX16

DIOPT Version :9

Sequence 1:NP_001262589.2 Gene:l(3)neo43 / 41851 FlyBaseID:FBgn0011476 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_012531.1 Gene:COX16 / 853454 SGDID:S000003540 Length:118 Species:Saccharomyces cerevisiae


Alignment Length:83 Identity:25/83 - (30%)
Similarity:47/83 - (56%) Gaps:5/83 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YGIPFLIMMVAGSFGLQQFSNLRYQYA--KKQPVTPEEMKKYGVSMKNRKDVTLESEYDKVKSVD 80
            :|:||...:|.|||.|..|:.::|:..  |.|.:..|::.|.   .||:::..::.||.:::.:.
Yeast    37 FGLPFCATIVLGSFWLSSFTAIKYEQGDRKVQEINEEDILKI---RKNQREFDIKEEYYRLQGLS 98

  Fly    81 IENWENKRGPRPWEEQED 98
            .|:||..|..|..:|.|:
Yeast    99 EEDWEPVRVARLKDESEN 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo43NP_001262589.2 COX16 16..94 CDD:404938 23/77 (30%)
COX16NP_012531.1 COX16 35..111 CDD:404938 23/76 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345157
Domainoid 1 1.000 44 1.000 Domainoid score I3146
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I1872
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005402
OrthoInspector 1 1.000 - - oto100040
orthoMCL 1 0.900 - - OOG6_106785
Panther 1 1.100 - - LDO PTHR17130
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.890

Return to query results.
Submit another query.