DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo43 and Cox16

DIOPT Version :9

Sequence 1:NP_001262589.2 Gene:l(3)neo43 / 41851 FlyBaseID:FBgn0011476 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_079737.1 Gene:Cox16 / 66272 MGIID:1913522 Length:106 Species:Mus musculus


Alignment Length:95 Identity:44/95 - (46%)
Similarity:60/95 - (63%) Gaps:10/95 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KSFKYGIPFLIMMVAGSFGLQQFSNLRYQYAKKQPVTPEEMKKYGVSMKNRKDVTLESEYDKVKS 78
            |:.:||:|.|:::|.|||||::||.:||. |....:.||..||..|:     .:||||||:|:|.
Mouse    14 KTLRYGVPMLLLVVGGSFGLREFSQIRYD-AVTIKIDPELEKKLKVN-----KITLESEYEKIKD 72

  Fly    79 VDIENWENKRGPRPWEE----QEDQPTTAK 104
            ...|||:|.|||||||:    |...|.|.|
Mouse    73 STFENWKNIRGPRPWEDPQLLQGRNPETLK 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo43NP_001262589.2 COX16 16..94 CDD:404938 37/77 (48%)
Cox16NP_079737.1 COX16 16..88 CDD:372923 37/77 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..106 11/22 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I8519
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5167
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46346
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005402
OrthoInspector 1 1.000 - - oto94551
orthoMCL 1 0.900 - - OOG6_106785
Panther 1 1.100 - - LDO PTHR17130
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5410
SonicParanoid 1 1.000 - - X4970
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.