DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo43 and COX16

DIOPT Version :9

Sequence 1:NP_001262589.2 Gene:l(3)neo43 / 41851 FlyBaseID:FBgn0011476 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_057552.1 Gene:COX16 / 51241 HGNCID:20213 Length:106 Species:Homo sapiens


Alignment Length:88 Identity:39/88 - (44%)
Similarity:59/88 - (67%) Gaps:6/88 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 YSTRKSFKYGIPFLIMMVAGSFGLQQFSNLRYQYAKKQPVTPEEMKKYGVSMKNRKDVTLESEYD 74
            :...|:..||:|.|:::|.|||||::||.:||. |.|..:.||..||    :|..| ::|||||:
Human    10 FRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYD-AVKSKMDPELEKK----LKENK-ISLESEYE 68

  Fly    75 KVKSVDIENWENKRGPRPWEEQE 97
            |:|....::|:|.|||||||:.:
Human    69 KIKDSKFDDWKNIRGPRPWEDPD 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo43NP_001262589.2 COX16 16..94 CDD:404938 36/77 (47%)
COX16NP_057552.1 COX16 18..88 CDD:316648 36/75 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 77..106 9/15 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 78 1.000 Domainoid score I8832
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5221
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46346
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005402
OrthoInspector 1 1.000 - - oto90966
orthoMCL 1 0.900 - - OOG6_106785
Panther 1 1.100 - - LDO PTHR17130
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5410
SonicParanoid 1 1.000 - - X4970
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1111.000

Return to query results.
Submit another query.