DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo43 and cox-16

DIOPT Version :9

Sequence 1:NP_001262589.2 Gene:l(3)neo43 / 41851 FlyBaseID:FBgn0011476 Length:105 Species:Drosophila melanogaster
Sequence 2:NP_001380207.1 Gene:cox-16 / 36804982 WormBaseID:WBGene00302991 Length:115 Species:Caenorhabditis elegans


Alignment Length:92 Identity:31/92 - (33%)
Similarity:53/92 - (57%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 STRKSFKYGIPFLIMMVAGSFGLQQFSNLRYQYAK-KQPVTPEEMKKYGVS---MKNRKDVTLES 71
            |..|..:.|:||..:::..::||..|..:|:.:.| ||.....|:.:..::   ::.|:.||:||
 Worm     2 SRLKFVRVGLPFFAIVLGSAYGLHFFQQVRFDFRKIKQEDDNLELLRSDLTRSGLRLREGVTVES 66

  Fly    72 EYDKVKSVDIENWENKRGPRPWEEQED 98
            .|.:|..:|.:||||.||||..|:..|
 Worm    67 VYKEVAELDTDNWENIRGPRDTEDLTD 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo43NP_001262589.2 COX16 16..94 CDD:404938 27/81 (33%)
cox-16NP_001380207.1 COX16 7..89 CDD:404938 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I7542
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I4046
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46346
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005402
OrthoInspector 1 1.000 - - oto17861
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR17130
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4970
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.070

Return to query results.
Submit another query.