DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)neo43 and cox16

DIOPT Version :9

Sequence 1:NP_001262589.2 Gene:l(3)neo43 / 41851 FlyBaseID:FBgn0011476 Length:105 Species:Drosophila melanogaster
Sequence 2:XP_012824536.1 Gene:cox16 / 100379706 XenbaseID:XB-GENE-961352 Length:107 Species:Xenopus tropicalis


Alignment Length:98 Identity:38/98 - (38%)
Similarity:61/98 - (62%) Gaps:16/98 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KSFKYGIPFLIMMVAGSFGLQQFSNLRYQ----YAKKQPVTPEEMKKYGVSMKNRKDVTLESEYD 74
            |:|:||.|.|::::.|||||::|:.:||.    ..|..|...|        :.::|.|:||||::
 Frog    13 KTFRYGAPMLLLIIGGSFGLKEFTQIRYDAQNLKRKMDPALEE--------LVSKKRVSLESEFE 69

  Fly    75 KVKSVDIENWENKRGPRPWEE----QEDQPTTA 103
            |:|..:.|:|:|.|||||||:    |.:|..:|
 Frog    70 KIKDSNYEDWKNVRGPRPWEDSKSLQLEQTNSA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)neo43NP_001262589.2 COX16 16..94 CDD:404938 32/81 (40%)
cox16XP_012824536.1 COX16 15..89 CDD:372923 32/81 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I9015
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5084
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1550606at2759
OrthoFinder 1 1.000 - - FOG0005402
OrthoInspector 1 1.000 - - oto104752
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5410
SonicParanoid 1 1.000 - - X4970
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.