DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRG15 and AT1G02740

DIOPT Version :9

Sequence 1:NP_001262588.1 Gene:MRG15 / 41850 FlyBaseID:FBgn0027378 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_171774.2 Gene:AT1G02740 / 839455 AraportID:AT1G02740 Length:327 Species:Arabidopsis thaliana


Alignment Length:395 Identity:96/395 - (24%)
Similarity:156/395 - (39%) Gaps:138/395 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FVDGERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGWSKNWDEWVPENRVLKYNDDNVKRRQE 86
            |.:|||||..|....|||||||.:......:|::||.||:|:||||:..:.:||::|:|:::::|
plant    52 FEEGERVLAKHSDCFYEAKVLKVEFKDNEWKYFVHYIGWNKSWDEWIRLDCLLKHSDENIEKQKE 116

  Fly    87 LARQCGERSKKDNKKGVYIPGSAKAKKMEQMRNESRASTPSKDSNTSQSTASSTPTTSAGPGSKS 151
            ...:         ::|:   .||.|.|:.:|:..|                   |..:.|     
plant   117 QGLK---------QQGI---KSAMAWKVSKMKPRS-------------------PNVARG----- 145

  Fly   152 EAGSTGTTTTNSTANSTTSRAHRKSTQSTPSTARPGTPSDKKEDPAAAETTEEEGPVAPKKKRMS 216
                                  ||..|.:..|.:...|||..                       
plant   146 ----------------------RKRKQDSVDTEKNVLPSDNL----------------------- 165

  Fly   217 EQRPSLTGSDVAEKPLPPTTTPSTPTTEPAPCVESEEAYAAKVEVKIKIPDELKHYLTDDWYAVV 281
                                                        :...||..|:..|.||:..|.
plant   166 --------------------------------------------LSFNIPPALRKQLLDDFEFVT 186

  Fly   282 REHKLLELPAKVTVQQISEQYL--AHKKSVKSTSASKEVAINDVLDGIVEYFNVMLGSQLLYKFE 344
            :..||::||....|..|.::|:  ..||..:.|.     ::.::|.|:..||:..|...|||..|
plant   187 QMQKLVQLPRSPNVDGILKKYIDSQMKKHGRVTD-----SLEEILKGLRCYFDKALPVMLLYNNE 246

  Fly   345 RTQYADVMQ--KHPDTPLSELYGSFHLLRLFVRLGSMLSYSALDQQSMQNLLTHVQDFLKFLVKN 407
            |.||.:.:.  ..|.|    :||:.|||||||:|..:|.:..:.:::::.|..:..|.|:||.||
plant   247 RKQYEESVSGGVSPST----VYGAEHLLRLFVKLPELLVHVNMAEETLKELQDNFVDILRFLRKN 307

  Fly   408 SSIFF 412
            .|:.|
plant   308 QSVLF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRG15NP_001262588.1 Tudor-knot 22..75 CDD:288553 24/52 (46%)
MRG 249..415 CDD:283390 51/168 (30%)
AT1G02740NP_171774.2 PLN00104 4..>101 CDD:215056 24/48 (50%)
CBD_MSL3_like 56..112 CDD:350846 26/55 (47%)
MRG 148..315 CDD:399022 56/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 102 1.000 Domainoid score I2304
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 191 1.000 Inparanoid score I1381
OMA 1 1.010 - - QHG55560
OrthoDB 1 1.010 - - D1624495at2759
OrthoFinder 1 1.000 - - FOG0002343
OrthoInspector 1 1.000 - - otm2582
orthoMCL 1 0.900 - - OOG6_102009
Panther 1 1.100 - - O PTHR10880
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1774
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.