DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRG15 and Arid4a

DIOPT Version :9

Sequence 1:NP_001262588.1 Gene:MRG15 / 41850 FlyBaseID:FBgn0027378 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_036013289.1 Gene:Arid4a / 238247 MGIID:2444354 Length:1283 Species:Mus musculus


Alignment Length:418 Identity:91/418 - (21%)
Similarity:148/418 - (35%) Gaps:89/418 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GEVKPAKVENYSTGTDANTLFVDGERVLCFHGPLIYEAKVLKTKPDATPVEYYIHYAGWSKNWDE 66
            ||.:....|...|||.....:..|:.      ..||||.:..|:.|...:.|.:||.||:..:||
Mouse   566 GEDEEDDTEPCLTGTKVKVKYGRGKT------QKIYEASIKSTEMDDGEILYLVHYYGWNVRYDE 624

  Fly    67 WVPENRVL---------KYNDDNVKRRQELARQC----------GERSKKDNKKGVYIPGSAKAK 112
            ||..:|::         |.....||.:..|...|          ...:|:|         |.|.:
Mouse   625 WVKADRIIWPLDKGGPKKKQKKKVKCQPCLLAHCTLGHAFCPVPAVENKED---------SEKDE 680

  Fly   113 KMEQMRNESRASTPSKDSNTSQSTASSTPTTSAGPGSKSEAGSTGTTTTNSTANST--------- 168
            |.::.|.:|:...|...|..|.:...|...||...| ||::.|:.:...:....|:         
Mouse   681 KRDEERQKSKRGRPPLKSTFSPNMPYSLSKTSNSEG-KSDSCSSDSEADDQLEKSSGGEDLSPDV 744

  Fly   169 ------TSRAH-RKSTQSTPSTARPGTPSDKKEDPAAAETTEEEG--------------PVAPKK 212
                  ...|| .|..:..|........:|:.:...:...|.|.|              .|...|
Mouse   745 KEELEKNENAHDDKLDEENPKIVHISKENDRTQAQPSDTLTVEAGDSDQIVHIFGDKVDQVEEFK 809

  Fly   213 KRMSEQRPSLTGSDVAEKPLPPTTTPSTPTTEPAPCVESEEAYAAKVEV-KIKIPD-ELKHYLT- 274
            |:: |:.|...|.....|.|      |....:.:|..:.|....|..:| .::... |.|::.: 
Mouse   810 KQV-EKSPKGKGRRSKTKDL------SLELIKISPFGQEEAGSEAHGDVHSLEFSSLECKNFSST 867

  Fly   275 -DDWYAVVREHKLLELPAKVTVQQISEQYLAHKKSVKSTSASKEVAIND--VLDGIVEYFNVMLG 336
             ||.....:|.|   |..|:..||..|:.|.....::.|:...:...:|  ..:|       |.|
Mouse   868 EDDIDPYEKEKK---LKRKILGQQSPEKKLRLDNGMEMTTGVSQERSDDGAGAEG-------MKG 922

  Fly   337 SQLLYKFE-RTQYADVMQKHPDTPLSEL 363
            :.:...|| ..:....:...||..|.||
Mouse   923 AHVEQHFETEGEGMPSLTAEPDQGLQEL 950

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRG15NP_001262588.1 Tudor-knot 22..75 CDD:288553 17/61 (28%)
MRG 249..415 CDD:283390 27/122 (22%)
Arid4aXP_036013289.1 Tudor_ARID4A_rpt1 4..61 CDD:410530
Tudor_SF 62..118 CDD:413384
RBB1NT 170..262 CDD:400474
ARID_ARID4A 312..397 CDD:350646
CBD_RBP1_like 580..638 CDD:350843 18/63 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.