DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MRG15 and arid4b

DIOPT Version :9

Sequence 1:NP_001262588.1 Gene:MRG15 / 41850 FlyBaseID:FBgn0027378 Length:429 Species:Drosophila melanogaster
Sequence 2:XP_005173089.1 Gene:arid4b / 100537923 ZFINID:ZDB-GENE-160607-1 Length:1240 Species:Danio rerio


Alignment Length:215 Identity:50/215 - (23%)
Similarity:83/215 - (38%) Gaps:48/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YEAKVLKTKPDATPVEYYIHYAGWSKNWDEWVPENRVLKYNDDNV---------KRRQELARQCG 92
            |:|.|.::..:...|.|.:||.||:..:|||:..:::::..:.||         |.:.|..|...
Zfish   560 YDATVKESNLEGGEVLYLVHYCGWNVRYDEWIKADKIVRPANKNVPKIKHRKKIKNKAERERDRI 624

  Fly    93 ER--------SKKD--NKKGVYIPGSAKAKKMEQMRNESRASTPSKDSNTSQSTASSTPTTSAGP 147
            ||        |.|:  |:......|.....|||:..::.           :|.:...|...:..|
Zfish   625 ERLADREDLPSSKNRINRLSKVNSGGDVFSKMEECVDKG-----------NQQSIEITSILNGLP 678

  Fly   148 GSKSEAGSTGTTTTNSTANSTTSRAHRKSTQSTPSTARPGTPSDKKEDPAAAETTEEEG--PVAP 210
            ||                :|:|..:.|:..:..........|...|.||..::..|:..  |.||
Zfish   679 GS----------------DSSTDDSEREEDEDADHDEDDDHPGAHKADPPQSQHWEKNSSPPEAP 727

  Fly   211 KKKRMSEQRPSLTGSDVAEK 230
            |....:||.|:|..|..|.|
Zfish   728 KTPADAEQEPTLQDSTEAPK 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MRG15NP_001262588.1 Tudor-knot 22..75 CDD:288553 12/37 (32%)
MRG 249..415 CDD:283390
arid4bXP_005173089.1 TUDOR 60..109 CDD:197660
RBB1NT 170..264 CDD:285392
ARID 309..394 CDD:198082
Tudor-knot 543..596 CDD:288553 12/35 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3001
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.