DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4338 and AT5G10070

DIOPT Version :9

Sequence 1:NP_650441.1 Gene:CG4338 / 41849 FlyBaseID:FBgn0038313 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_974761.1 Gene:AT5G10070 / 830871 AraportID:AT5G10070 Length:266 Species:Arabidopsis thaliana


Alignment Length:231 Identity:109/231 - (47%)
Similarity:149/231 - (64%) Gaps:2/231 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ASSSSSENESSDSESSG-DGAQNDLGQPPEFAVAMWDLNHCDPKKCSGRKLARLGLISNLRLGQK 101
            :|...::|.:.:.||.. |....|....|:..:||||...||.|:|:||||||..|:..||:...
plant    14 SSRGRTDNLAREDESLPLDQEPEDEAPVPKVQLAMWDFGQCDAKRCTGRKLARFNLLKELRVNTG 78

  Fly   102 FPGLVLSPVGQLCVSPLDRDVVASSGVAVIDCSWAKLDETPFGRMRSPHPRLLPFLVAANPINYG 166
            |.|:||||||:.|||..|.|::...|:||:|||||:|.:.||.::|...|||||:||||||:|||
plant    79 FGGVVLSPVGRQCVSREDYDLIKRKGLAVVDCSWARLTDVPFAKLRCTAPRLLPWLVAANPVNYG 143

  Fly   167 KPCKLSCVEAIAATLYICGFTEEARWFLGKFSWGHAFLELNDKLLNAYAACKSSDEIVKVQNEYL 231
            :||:||||||::|.|.:||..|.|...||||.||||||.||..:|..|:.|::|.||:.|||.:|
plant   144 RPCELSCVEALSAALILCGEKETAELLLGKFKWGHAFLSLNKDILKEYSKCENSAEIISVQNSWL 208

  Fly   232 EKEQQERDKPRDLRDFYPTSSSSSSSETETEGDDED 267
            .::.|...:|..|.:.........|.: |:|.||||
plant   209 TQQTQIPKQPPALEERKDVKKDGESGD-ESEEDDED 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4338NP_650441.1 Tsr3 69..233 CDD:224953 92/163 (56%)
RLI 69..101 CDD:281988 17/31 (55%)
DUF367 105..229 CDD:281963 71/123 (58%)
AT5G10070NP_974761.1 RLI 44..75 CDD:397953 16/30 (53%)
Ribo_biogen_C 82..207 CDD:397928 72/124 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 164 1.000 Domainoid score I1232
eggNOG 1 0.900 - - E1_COG2042
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6922
Inparanoid 1 1.050 222 1.000 Inparanoid score I1201
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222562at2759
OrthoFinder 1 1.000 - - FOG0004488
OrthoInspector 1 1.000 - - oto2932
orthoMCL 1 0.900 - - OOG6_101679
Panther 1 1.100 - - LDO PTHR20426
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3182
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.830

Return to query results.
Submit another query.