DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4338 and tsr3

DIOPT Version :9

Sequence 1:NP_650441.1 Gene:CG4338 / 41849 FlyBaseID:FBgn0038313 Length:274 Species:Drosophila melanogaster
Sequence 2:NP_001017135.1 Gene:tsr3 / 549889 XenbaseID:XB-GENE-1006468 Length:313 Species:Xenopus tropicalis


Alignment Length:307 Identity:134/307 - (43%)
Similarity:172/307 - (56%) Gaps:52/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KGKKGGGGPYRNVKANHNCARSFAQQANELASSSSSENESSDSESSGDGAQNDLGQPPEF----A 68
            |.:|.|....:..:..|..|      :..|.:.:|..:|:.|:....|||:   |...:|    |
 Frog     5 KAQKDGRAAPKQKECRHKKA------SKSLEAFASEVHEALDASIQEDGAE---GSDTKFKFPCA 60

  Fly    69 VAMWDLNHCDPKKCSGRKLARLGLISNLRLGQKFPGLVLSPVGQLCVSPLDRDVVASSGVAVIDC 133
            :|||:|.|||||:|:||||.|.||:.|||:.|:|.||:|||:|.|.|||.|:.:||.||||||||
 Frog    61 LAMWELGHCDPKRCTGRKLVRKGLVRNLRINQRFNGLILSPMGTLYVSPADKQIVADSGVAVIDC 125

  Fly   134 SWAKLDETPFGRMRSPHPRLLPFLVAANPINYGKPCKLSCVEAIAATLYICGFTEEARWFLGKFS 198
            ||||||||||.:||..||||||:||||||:|||:|||||||||.|||..|.||.|.|...|.||.
 Frog   126 SWAKLDETPFTKMRGSHPRLLPYLVAANPVNYGRPCKLSCVEAFAATFCIVGFPELATILLRKFK 190

  Fly   199 WGHAFLELNDKLLNAYAACKSSDEIVKVQNEYL-------------------------------- 231
            ||..|||||..||..|:.|::.:|::.|:.|||                                
 Frog   191 WGKVFLELNKDLLEKYSNCQNMEEVLNVEKEYLATASAKDTDDIDPFDVESGREFSNLNRDITSD 255

  Fly   232 ------EKEQQERDKPRDLRDFYPTSSSSSSSETETEGDDEDTKAKP 272
                  |.:..|.|.. |..|....|.|...:.:|.|.:||...:||
 Frog   256 RKANNYEDDTDEEDDD-DAEDGTDDSESDKEAGSEEESNDEAAASKP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4338NP_650441.1 Tsr3 69..233 CDD:224953 106/201 (53%)
RLI 69..101 CDD:281988 20/31 (65%)
DUF367 105..229 CDD:281963 80/123 (65%)
tsr3NP_001017135.1 Tsr3 50..223 CDD:224953 107/172 (62%)
RLI 61..93 CDD:281988 20/31 (65%)
DUF367 97..221 CDD:281963 80/123 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 177 1.000 Domainoid score I3542
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6922
Inparanoid 1 1.050 241 1.000 Inparanoid score I3256
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1222562at2759
OrthoFinder 1 1.000 - - FOG0004488
OrthoInspector 1 1.000 - - oto104948
Panther 1 1.100 - - LDO PTHR20426
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1565
SonicParanoid 1 1.000 - - X3182
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.