DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp190 and IWS1

DIOPT Version :9

Sequence 1:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster
Sequence 2:XP_005263764.1 Gene:IWS1 / 55677 HGNCID:25467 Length:824 Species:Homo sapiens


Alignment Length:607 Identity:131/607 - (21%)
Similarity:223/607 - (36%) Gaps:202/607 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   551 GELEAHINEVHTDDNKQQCIYCNKVFEQELQLYRHMKSYHKEQALEDGIIDETDEEFLGSQDEEE 615
            |.:|.| :|..|.|.           |..|....|:.....::.|.....|...||....:|.:.
Human    48 GSVERH-SENETSDR-----------EDGLPKGHHVTDSENDEPLNLNASDSESEELHRQKDSDS 100

  Fly   616 EAEGDEEQEPEQTGKVRILSDISLPATSAITVQQAQQEQLQEEDVEQ------VQQEVKFVGADG 674
            |:|  |..||              ||:.:           :.|||.|      .::..|..|:|.
Human   101 ESE--ERAEP--------------PASDS-----------ENEDVNQHGSDSESEETRKLPGSDS 138

  Fly   675 NEVEL-----TDEQRKEI---------LSQLNQQQA--GATAGGVVMVLSEPEAEHVKQETDEKS 723
            ...||     :|.:.:::         :.:|.:..|  ..|...:...:|:.|:|    |.....
Human   139 ENEELLNGHASDSENEDVGKHPASDSEIEELQKSPASDSETEDALKPQISDSESE----EPPRHQ 199

  Fly   724 LAGTEEEYDDSQIYSELGAADSVESAKKNIAD-ESKE-------SIDNLEWAENLIAESEEQSNK 780
            .:.:|.|.......|:   ::|.|..|..::| ||:|       ..:|.|..:..|::||.:   
Human   200 ASDSENEEPPKPRMSD---SESEELPKPQVSDSESEEPPRHQASDSENEELPKPRISDSESE--- 258

  Fly   781 EPKSDKPRDDISEKLKELTGDWTEDE-------NDDDVDDKPATAELASELANKD-PEPTVHEEE 837
                |.||...|:         :|:|       :|.:.:|.|...  ||:..|:: |:|.|.:.|
Human   259 ----DPPRHQASD---------SENEELPKPRISDSESEDPPRNQ--ASDSENEELPKPRVSDSE 308

  Fly   838 DDIDLALQSLHKGP--EEATEEKASEESVTSADDAVDAVPNINSQPEKMDVDSEAADEKASKAEV 900
            .      :...|||  :..||:.:..:....:||               |.|.|      :|.| 
Human   309 S------EGPQKGPASDSETEDASRHKQKPESDD---------------DSDRE------NKGE- 345

  Fly   901 QIKKEAELENDQEEFIKEDSPIPHSDSVAELREAVTASEGEDDVH----LEADNIRKELLDELIA 961
                :.|::||..          ||||..: |:...:|:.|::.|    :::|...||      .
Human   346 ----DTEMQNDSF----------HSDSHMD-RKKFHSSDSEEEEHKKQKMDSDEDEKE------G 389

  Fly   962 EAEKPDQEKDIV----QSEENATTEALDRSVTDEDDLVPPTQVSTEQMEIDEPAAEKAAENNEDT 1022
            |.||..:.|..|    :.||.|:.:. .|.|:|.||             .|..|....:...|.|
Human   390 EEEKVAKRKAAVLSDSEDEEKASAKK-SRVVSDADD-------------SDSDAVSDKSGKREKT 440

  Fly  1023 RTAD-EKEA---VEDKPNQTQDVTTAEKPTLESAKAGDEATSGEAASVDKVKSLISEWGDDDED- 1082
            ..:| |:||   :.||.|:.:|:            .|.::.||.... :.:..:..|.||::|: 
Human   441 IASDSEEEAGKELSDKKNEEKDL------------FGSDSESGNEEE-NLIADIFGESGDEEEEE 492

  Fly  1083 ---------EDENGVSAAAKEE 1095
                     |:|.|.:...:.|
Human   493 FTGFNQEDLEEEKGETQVKEAE 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371 6/16 (38%)
C2H2 Zn finger 569..586 CDD:275371 2/16 (13%)
IWS1XP_005263764.1 Opi1 233..>337 CDD:285782 29/142 (20%)
TFIIS_I <533..797 CDD:294098
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.