DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp190 and Dtg

DIOPT Version :9

Sequence 1:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_650220.2 Gene:Dtg / 41558 FlyBaseID:FBgn0038071 Length:612 Species:Drosophila melanogaster


Alignment Length:539 Identity:110/539 - (20%)
Similarity:189/539 - (35%) Gaps:170/539 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   613 EEEEAEGD-------EEQEPEQTGKVRILSDISLPATSAITVQQAQQEQLQEEDVEQVQQEVKFV 670
            |.::.||.       ||..|.....::..:..:||.        .:.:..:...|:.|:....||
  Fly    50 EVDDVEGTTILPIQLEESSPTPEPIIKNETATALPV--------VELKVAESNPVDPVEATDNFV 106

  Fly   671 GADGNEVELTDEQRKEILSQLNQQQAGATAG-----GVVMVLSEPEAEH------VKQETDEKSL 724
            ...|..:|      ::|.:.:|.:...|.:.     ..|..::|.|.|:      |:...:.|||
  Fly   107 SVYGGNLE------QDIKNDVNSEVEDAPSPVEPIIEEVQKVAEAELENHEIKLAVQSAREPKSL 165

  Fly   725 AGTEEE--YDDSQIYSELGAADSVESAKKNIA-------------------------DESKESID 762
            ...||.  .|:.::.::    |..|:...|||                         :|.|...:
  Fly   166 DAEEESKTIDEDRLENQ----DKAETVTDNIAVSSEQMESHIRPLPNVTSDLVSVILNEDKAITE 226

  Fly   763 NLEWAENLIA--------ESEEQSNKEPKSDKPRDDISEKLKELTGDWTEDENDDDVDDKPATAE 819
            ......||:|        |..::|...|..::|:..:::|              ..|:| |:|.|
  Fly   227 QPITKTNLLALEQEHEKFEEIDESTTVPVYEEPKHQVTKK--------------QGVED-PSTVE 276

  Fly   820 LASELANK---DP--EPTVHEEEDDIDLALQSLHKGPEEATEEKASEESVTSADDAVDAVPNINS 879
            :..|::::   ||  ||....:|.:::     .|...:....|...|.....|..:..|.|.:..
  Fly   277 IPPEVSDEQHFDPSEEPQTVRDERNLE-----EHDDNQNEINENIIEGEEAPAKTSTTAGPLVTV 336

  Fly   880 QPEKMDVDSEAADEKASKAEVQIKKEAELENDQEEFIKEDSPIPHSDSVAELREAVTASEGEDDV 944
            :|.|...:        ...|::.|.|||.:.:.||.::.::|     ||.....|....|.:|:|
  Fly   337 EPTKSITE--------PNEEIEKKAEAEAKAEMEEQVEVNTP-----SVDATVVAADPDEAQDEV 388

  Fly   945 HLEADNIRKELLDELIAEAEKPDQEKDIVQSEENATTEALDRSVTDEDDLVPPTQVSTEQMEIDE 1009
                  |..|...|.|.||.|      ||..||                  |...||.:|..:.|
  Fly   389 ------IVAETTVEAITEAAK------IVVEEE------------------PKEDVSVQQEHLKE 423

  Fly  1010 PAAEKAAENNEDTRTADE--KEAV-----EDKPNQTQDVTTAEKPTLESAKAGDEATSGEAASVD 1067
            ...:..:|:|......:|  ||.:     ::.|.:.....:.||||             |.|.| 
  Fly   424 QRVQTVSESNRQASPTEEPIKEVIFPKGDDESPVEGDSSESDEKPT-------------ERAIV- 474

  Fly  1068 KVKSLISEWGDDDEDEDEN 1086
                      |||..|::|
  Fly   475 ----------DDDSSEEQN 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371
C2H2 Zn finger 569..586 CDD:275371
DtgNP_650220.2 PTZ00341 <112..325 CDD:173534 44/242 (18%)
rne <303..445 CDD:236766 41/189 (22%)
DUF3295 <410..>498 CDD:288540 23/98 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.