DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp190 and IBSP

DIOPT Version :9

Sequence 1:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_004958.2 Gene:IBSP / 3381 HGNCID:5341 Length:317 Species:Homo sapiens


Alignment Length:294 Identity:62/294 - (21%)
Similarity:101/294 - (34%) Gaps:93/294 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   560 VHTDDNKQQCIYCNKVFEQELQLYRHMKSY-HKEQALEDGIIDETDEEFLGSQDEEEEAE----- 618
            |..:|:::..::   .:.....||:|...| |.::....|..|.::|....|.:||||.|     
Human    26 VKIEDSEENGVF---KYRPRYYLYKHAYFYPHLKRFPVQGSSDSSEENGDDSSEEEEEEEETSNE 87

  Fly   619 --------GDEEQEPEQ--------------------TGKVRILSDISLPATSAITVQQAQQEQL 655
                    .||:.|.|.                    ||    |:.|.||..:.....:|.:|  
Human    88 GENNEESNEDEDSEAENTTLSATTLGYGEDATPGTGYTG----LAAIQLPKKAGDITNKATKE-- 146

  Fly   656 QEEDVEQVQQEVKFVGADGNEVELTDEQRKEILSQLNQQQAGATAGGVVMVLSEPEAEHVK---- 716
            :|.|.|:.::|      :|||.|.::.:..|     |:|....|:      .:..|||:..    
Human   147 KESDEEEEEEE------EGNENEESEAEVDE-----NEQGINGTS------TNSTEAENGNGSSG 194

  Fly   717 ----QETDEKSLAGTEEEYDDSQIYSELGAADSVESAKKNIADE---------------SKESID 762
                :|.:|:|:.|...|  |:......|...|..:...|...|               .|.:..
Human   195 GDNGEEGEEESVTGANAE--DTTETGRQGKGTSKTTTSPNGGFEPTTPPQVYRTTSPPFGKTTTV 257

  Fly   763 NLEWAENLIAESE--------EQSNKEPKSDKPR 788
            ..|........:|        |..|.||:.|..|
Human   258 EYEGEYEYTGANEYDNGYEIYESENGEPRGDNYR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371 2/7 (29%)
C2H2 Zn finger 569..586 CDD:275371 2/16 (13%)
IBSPNP_004958.2 BSP_II 17..314 CDD:283165 62/294 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..254 46/220 (21%)
cell-attachment tripeptide 286..288 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.