DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp190 and Muc18B

DIOPT Version :9

Sequence 1:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster


Alignment Length:227 Identity:43/227 - (18%)
Similarity:84/227 - (37%) Gaps:64/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   915 FIKEDSPIPHSDSVAELREAVTASEGEDDVHLEADNIRKELLDELIAEAEKPDQE---------- 969
            |::..:.:..|.|:|:..:::.|.|..||.::|...|....|||  :..|||..|          
  Fly    55 FLRCPAGLVFSSSMAQCVQSIAAFEARDDSNIENPTIPPSNLDE--STTEKPATEAPGTTEKVTT 117

  Fly   970 -----KDIVQSEENATTEALDRSVTDEDDLV--------------------------------PP 997
                 .:.|.:|...|||.:........:.:                                |.
  Fly   118 AAPGTTEKVTTEAPGTTEKITTEAPGTTEKITTEAPGTTEKITTEAPGTTEKITTEAPGTTEKPA 182

  Fly   998 TQV--STEQMEIDEPAAEKAAENNEDTRTADEKEA---VEDKPNQTQDVTTAEKPTLESAKAGDE 1057
            |..  :||:...|.|...:.:|..:...|.|:.:.   :.|:|:..:  |:.::|..|:.::|:|
  Fly   183 TDAPGTTEKPATDAPGTTEKSETTDAPGTTDKSDTDAPITDEPSTAE--TSTDEPNTETTESGEE 245

  Fly  1058 --------ATSGEAASVDKVKSLISEWGDDDE 1081
                    ||:|...:......::..:.:.||
  Fly   246 TTIEDNVCATTGLFPTGSCTHFIVCSYAEGDE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371
C2H2 Zn finger 569..586 CDD:275371
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884 4/16 (25%)
MCLC <77..177 CDD:283562 18/101 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.