DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp190 and CG9915

DIOPT Version :9

Sequence 1:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_001097000.1 Gene:CG9915 / 32593 FlyBaseID:FBgn0030738 Length:820 Species:Drosophila melanogaster


Alignment Length:385 Identity:64/385 - (16%)
Similarity:151/385 - (39%) Gaps:102/385 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   722 KSLAGTEEEYDDSQIYSELGAADSVESAKKNIADESKESIDNLEWAENLIAESEEQSNKEPK--- 783
            :|::|...:  .|:..|...|:.:....|:....||.:....:......|.:::.:.:::.|   
  Fly   437 RSISGGSRK--GSRSRSGSAASQTASRRKRRAISESDDDGPKVTKKRVKITDTDNEEDEQDKGIG 499

  Fly   784 SDKPRDDISEKLKELTGDWTEDENDDDVDDKPATAELASE----LANKDPEPTVHEEEDDIDLAL 844
            .:|.:|.|:|.        ::||| ..:.::|..:...|:    |..|..|..|...:.||||  
  Fly   500 KEKSQDKITES--------SDDEN-TPISNEPENSNFISDFDAMLMRKKEEKRVRRRKRDIDL-- 553

  Fly   845 QSLHKGPEEATEEKASEESVTSADDAVD----AVPNINSQPEKMDVDSEAADEKASKAEVQIKKE 905
                               :...||.:|    ::.|.:....::::..:.|.:|.|..: |:..:
  Fly   554 -------------------INDNDDLIDQLIVSMKNASDDDRQLNMIGQPATKKISMLK-QVMSQ 598

  Fly   906 AELENDQEEFIKED---------SPIPH-SDSVAELREAV--------TASEG---EDDV----- 944
            ...::.|..|::.:         :|:|: |....::||::        |..:|   :..:     
  Fly   599 LIKKHLQLAFLEHNILNVLTDWLAPLPNKSLPCLQIRESILKLLSDFPTIEKGLLKQSGIGKAVM 663

  Fly   945 ----HLEADNIRKELLDELIAEAEKP---------------DQEKDIVQ----------SEENAT 980
                |.:.....::....||:|..:|               .||:|:.|          :|.:::
  Fly   664 YLYKHPQETKSNRDRAGRLISEWARPIFNVSCNFSAMSKEERQERDLAQMSRHRHKSPDTEPSSS 728

  Fly   981 TEA--LDRSVTDEDDLVPPTQVS-TEQMEIDEPAAEKAAENNEDTRTADEKEAVEDKPNQ 1037
            ::|  |::::::||.::.|.... ..:..:..|:.:......:.|...:...:.:.|||:
  Fly   729 SKAPTLNQTLSNEDKMLRPGDPGWVARARVPMPSNKDYVIRPKSTVEGEVSASTKRKPNR 788

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371
C2H2 Zn finger 569..586 CDD:275371
CG9915NP_001097000.1 TFIIS_I <568..775 CDD:294098 31/207 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458107
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.