DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp190 and Samd15

DIOPT Version :9

Sequence 1:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_001277217.1 Gene:Samd15 / 238333 MGIID:2685109 Length:620 Species:Mus musculus


Alignment Length:563 Identity:111/563 - (19%)
Similarity:200/563 - (35%) Gaps:168/563 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 INEVHTDDNKQQCIYCNKVFEQELQLY-RHMKSYHKEQALEDGIIDETDEEFLGSQDEEEEAEGD 620
            ::||..|.|...        ::.|.|. :..||.....|..|.:. |...:...:.|.:....|:
Mouse     1 MSEVSGDYNSDS--------DESLSLQPKRTKSGKLHNANADTLF-EVSSKLSPNTDRDPGNVGN 56

  Fly   621 EEQEPEQTGKVRIL-------------SDISL------PATSAITVQQAQQEQLQEEDV--EQVQ 664
            ...||.:|.|..::             .|:|:      |..:...:......:.:..|:  |:::
Mouse    57 VPLEPTRTRKGDLVPVGKNHEVPDLQRQDVSVGVFKGPPTRTGTQLPTKIDPEQKTPDIRSEKLR 121

  Fly   665 QEVKFVGADGNEVELTDEQRKEILSQLNQQQAGATAGGVVMVLSEPE--AEHVKQETDEKSL--- 724
            :.|:......:::..:::::||.:.:.:.:....|         :|:  ...:::.|:|..|   
Mouse   122 KSVEEEALPPSKMTKSEKKQKESIKEKSTEPYEVT---------KPKFPDRKLRKSTEEADLKPH 177

  Fly   725 ------AGTEE----EYDDSQIYSELGAADSVESAKKNIA-------DESKESIDNLEWAENLIA 772
                  :|||:    ::.|.::.         :|.||.::       :||:..||.         
Mouse   178 FKSTEQSGTEQPEQTKFPDKKLR---------QSTKKKVSGPLEDFEEESRRPIDE--------- 224

  Fly   773 ESEEQSNKEP-KSDK--PRDDISEKLKELTGDWTEDENDDDVDDKPATAELASELANKDPEP--- 831
            .|.|.|.|.| |:.|  .:....||..|:    .|....:.:||:..|.|  ..:..|.|||   
Mouse   225 ASLELSQKRPLKASKKAQKSSFDEKFPEM----LEQITVELLDDQEETQE--ESIKEKVPEPLGD 283

  Fly   832 ---------------------TVHEEEDDIDLALQSLHKGPEE---ATEEKASEESVTSADDAVD 872
                                 |:.|...|.|..||:..:.|:|   .|.||..::.....|    
Mouse   284 RKPSAQKHKLRKSSERSKLKDTLIEPSKDKDPGLQTQTEFPKEKLIKTTEKTGDKPQQITD---- 344

  Fly   873 AVPNI--NSQPEKMDVDSEAADEKASKAEVQIKKEAELENDQEEFIKEDSPIPHSDSVAELREAV 935
              |:|  .||||..:.:.|..::...:.|..:.||     |:.|..|.:.|              
Mouse   345 --PDIQEKSQPEPTEKNLELPNKPKPEEERDLPKE-----DKPESSKPNYP-------------- 388

  Fly   936 TASEGEDDVHLEADNIRKELLDELIAEAEKPDQEKDIVQSEENATTEALDRSVTDEDDLVPPTQV 1000
               .|:|.:.|.|     ::..|.|..:.:...|......|   |.|.|....||.::|.|....
Mouse   389 ---AGKDKLALPA-----KIKTEFIVGSPRESVESFSTLYE---TQEFLKDLQTDMNELFPIVDA 442

  Fly  1001 STEQMEIDEPAAEKAAENNEDTRTADEKEAV---EDKPNQTQD 1040
            |..|.|:           .:.|....|.|.:   |.||:.|.:
Mouse   443 SESQTEL-----------RDSTVLPQEVELLGRKETKPSLTPE 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371 4/10 (40%)
C2H2 Zn finger 569..586 CDD:275371 2/17 (12%)
Samd15NP_001277217.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..394 88/462 (19%)
SAM_Samd14 478..544 CDD:188929
SAM 479..533 CDD:197735
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..620
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167843287
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.