DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp190 and ZNF652

DIOPT Version :9

Sequence 1:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_001138837.1 Gene:ZNF652 / 22834 HGNCID:29147 Length:606 Species:Homo sapiens


Alignment Length:449 Identity:90/449 - (20%)
Similarity:150/449 - (33%) Gaps:131/449 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NVATPIAQRA--NTQRGSTGNTMSRTSGGSNRSPYGDSSNVKQEPTSPFEQLRKGYNNNKRPAQT 229
            |.|..:|..|  :::||...::...   |:|:.....:...|:|..||:               :
Human    14 NCAVHVAGMAQEDSRRGQVPSSFYH---GANQELDLSTKVYKRESGSPY---------------S 60

  Fly   230 SLLSPPSKKPSLEEVKEFAEQQRMRKQIAAEYGDNDPEYDGGMLYDDVHA------GDDDDDDMP 288
            .|:.....||.|.|.:|                  .|.:.......||||      ..||.::..
Human    61 VLVDTKMSKPHLHETEE------------------QPYFRETRAVSDVHAVKEDRENSDDTEEEE 107

  Fly   289 PQPSTSKQQSPQGTQTQLEHGSTTIILKQDSPSQTPTIIVK-DSSNAKLNHTKIIAEVLRQYPHI 352
            .:.|..::|                            |||: :.:|..||              :
Human   108 EEVSYKREQ----------------------------IIVEVNLNNQTLN--------------V 130

  Fly   353 VKGHKNIKLKIMPNTPAAPT-----EKSAPATVKPPANQSSATTSPHKKLHVSFKADKSTPLITA 412
            .||.|.:..: ...||...|     |:.:.......:|.........||..:..|. ..|...|.
Human   131 SKGEKGVSSQ-SKETPVLKTSSEEEEEESEEEATDDSNDYGENEKQKKKEKIVEKV-SVTQRRTR 193

  Fly   413 QQKAASSQQKSGTSQTTGNQGTGANPPAN--------TAAAQKRRIDSKTMHALIAQGAENTTGP 469
            :..:.::...|.|.:||..:.....||..        .|..||.:.:.|          |..|  
Human   194 RAASVAAATTSPTPRTTRGRRKSVEPPKRKKRATKEPKAPVQKAKCEEK----------ETLT-- 246

  Fly   470 WLCLRCGVNGRPISIPSYRGFRRHLINTHKETIDPALCEHCGWRSVNNRELHFHMYMEHQTKSLL 534
              |.:|   .|..:...|  ..:|:..||:..   .:|:.||.:.|...||..|...:.: |:: 
Human   247 --CEKC---PRVFNTRWY--LEKHMNVTHRRM---QICDKCGKKFVLESELSLHQQTDCE-KNI- 299

  Fly   535 YTFAECALCNQSYRTKGELEAHINEVH-TDDNKQQCIYCNKVFEQELQLYRHMKSYHKE 592
                :|..||:|::....|..||..|| ..:.|..|..|.|.|.....:.:||.::.|:
Human   300 ----QCVSCNKSFKKLWSLHEHIKIVHGYAEKKFSCEICEKKFYTMAHVRKHMVAHTKD 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371 10/28 (36%)
C2H2 Zn finger 569..586 CDD:275371 4/16 (25%)
ZNF652NP_001138837.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..113 11/59 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..235 20/106 (19%)
UFD1 <240..304 CDD:332114 19/91 (21%)
C2H2 Zn finger 247..266 CDD:275368 5/23 (22%)
C2H2 Zn finger 274..293 CDD:275368 7/18 (39%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
C2H2 Zn finger 331..351 CDD:275368 6/19 (32%)
C2H2 Zn finger 359..379 CDD:275368
SFP1 <381..464 CDD:227516
C2H2 Zn finger 387..407 CDD:275368
C2H2 Zn finger 415..435 CDD:275368
COG5048 439..>488 CDD:227381
C2H2 Zn finger 443..463 CDD:275368
C2H2 Zn finger 471..487 CDD:275368
Mediates interaction with CBFA2T3. /evidence=ECO:0000269|PubMed:16966434 498..606
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24394
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.