DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp190 and SAMD15

DIOPT Version :9

Sequence 1:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster
Sequence 2:NP_001010860.1 Gene:SAMD15 / 161394 HGNCID:18631 Length:674 Species:Homo sapiens


Alignment Length:576 Identity:121/576 - (21%)
Similarity:205/576 - (35%) Gaps:167/576 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   602 ETDEEFLGSQDEEEEAEGD-----------EEQEPEQTGKVRILSDISLPATSAITVQQAQQEQL 655
            |..|::....||:.|.|.:           |..||:...|    :|..|||    .:.|..|.:.
Human     3 EVPEDYDSGPDEDGELEPERPELPGLHKLYENAEPDTMAK----ADSKLPA----EIYQEPQPET 59

  Fly   656 QEEDVEQVQ----QEVKFVGADGNEVELTDEQRKEILSQLNQQQAGATAGGVVMVLSEPEAEHVK 716
            :|||.::.:    :.|:......::..:..|.::::.|:        |..|:        .:.||
Human    60 EEEDFKEGEPDSAKNVQLKPGGTSQEGIAKESKRDVPSE--------TEPGI--------HQEVK 108

  Fly   717 QETDEKS---LAGTEEEYDDSQIYSELGAADSVESAKKNIAD----ESKESID------------ 762
            .||..:.   ....|...|::...|:|   :..|.||.|:.:    ||....|            
Human   109 SETSREMGEFFKDLEAPMDETHKESDL---EPPEEAKPNVTEDVFLESAMETDPDPVPPTETMSE 170

  Fly   763 ---------NLEWAENLIAESE------------EQSNKEP----KSDKPRDDISEKLKE----- 797
                     |||..|.   |:|            |::..||    |.|.|.:.:.|.|:|     
Human   171 VSGATVRERNLELLEE---ETEPGVPEESLRVQHEETGLEPPEQTKQDFPSEKLGESLEETDLQP 232

  Fly   798 --LTGDWTEDENDDDVDDK-----PATAELASELANKDPEPTVHEEEDDIDLALQSLHKGPEE-- 853
              :|...|.:|...:..:|     |..|.|  |...|:|..:  .||..::...::..:.|||  
Human   233 PKMTKPETPEETQRESTEKKRTEPPEQARL--EFLEKEPRKS--SEEAGLEPPEETQPEVPEEMQ 293

  Fly   854 --ATEEKASEESVTSADDAVDAVPNINSQPEKMDVDSEAADEKASKAEVQIK---KEAELENDQE 913
              |||||.:|....:..|..|..|.            ::.||...:...:||   .|.|.....|
Human   294 RKATEEKGTELPERTKPDFPDHKPR------------KSTDENVPEPLEEIKLEFPEEESRKTNE 346

  Fly   914 EFIKEDSPIPHSDSVAELREAVTASEGEDDVHLEADNIRKELLDELIAEAEKPDQEKDIV----- 973
            |.|.|.|.:...:|..|:|::               |.:|        ..:.|::...::     
Human   347 ETILEQSEMMKPESPEEIRKS---------------NEKK--------NPQPPEETGPVLPQEIN 388

  Fly   974 -QSEENATTEALDRSVTDEDDLVP-PTQVSTEQMEIDEPAAEKAAENNEDTRTADEKEAVEDKPN 1036
             |.||...|:..::.:...|:..| .|.|...:.:..||...|.:..|      ||.|..|.|..
Human   389 PQVEEKTQTKPTEKILELPDETKPRETHVEFSKEDRPEPIKSKYSVGN------DELEHREPKRG 447

  Fly  1037 Q--TQDVTTAEKPTLESAKAGDEATSGEAASVDKVKSLIS-----EWGDDDEDEDE 1085
            :  ..|....|...|.|.:..:|:.......:..::.|::     .:.|..|.:.|
Human   448 KLSLSDKFRKEYYALGSLRESEESIGTHYEFLQPLQKLLNVSEECSYSDPSESQTE 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371
C2H2 Zn finger 569..586 CDD:275371
SAMD15NP_001010860.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..448 112/519 (22%)
ftsN 137..>310 CDD:274041 43/179 (24%)
SAM_Samd14 543..609 CDD:188929
SAM 544..607 CDD:197735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.