DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cp190 and Zfp791

DIOPT Version :9

Sequence 1:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster
Sequence 2:XP_008770655.1 Gene:Zfp791 / 100363196 RGDID:2323544 Length:533 Species:Rattus norvegicus


Alignment Length:149 Identity:40/149 - (26%)
Similarity:62/149 - (41%) Gaps:17/149 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   469 PWLCLRCGVNGRPISIPSYRGFRRHLINTHKETIDPALCEHCGWRSVNNRELHFHMYMEHQTKSL 533
            |:.|.:||.     :..|...|:|| :.||.|.| |..|:.||...|....|..|..:....|..
  Rat   392 PYECQQCGK-----AFISLENFQRH-VKTHTEDI-PYKCKECGKAFVFLSALRAHERIHTGEKPY 449

  Fly   534 LYTFAECALCNQSYRTKGELEAHINEVHTDDNKQQCIYCNKVFEQELQLYRHMKSYHKEQALEDG 598
                 ||..|.:::|....::.| ..:||.:...:|..|.|.|........||:.:..|:..:  
  Rat   450 -----ECKQCGKTFRCSSYVQVH-RRIHTGEKPYECKECGKTFIYSTSFRGHMRMHTGEKPYK-- 506

  Fly   599 IIDETDEEF-LGSQDEEEE 616
             ..|.::.| |||..:..|
  Rat   507 -CKECEKAFRLGSSLKRHE 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cp190NP_524359.2 BTB 20..122 CDD:279045
BTB 31..127 CDD:197585
C2H2 Zn finger 540..568 CDD:275371 6/27 (22%)
C2H2 Zn finger 569..586 CDD:275371 4/16 (25%)
Zfp791XP_008770655.1 KRAB 4..61 CDD:214630
KRAB 4..43 CDD:279668
COG5048 100..468 CDD:227381 25/88 (28%)
C2H2 Zn finger 104..124 CDD:275368
C2H2 Zn finger 141..161 CDD:275368
C2H2 Zn finger 169..189 CDD:275368
C2H2 Zn finger 197..217 CDD:275368
zf-H2C2_2 209..234 CDD:290200
C2H2 Zn finger 225..245 CDD:275368
C2H2 Zn finger 253..273 CDD:275368
C2H2 Zn finger 283..303 CDD:275368
zf-H2C2_2 296..320 CDD:290200
C2H2 Zn finger 311..331 CDD:275368
zf-H2C2_2 323..347 CDD:290200
C2H2 Zn finger 339..359 CDD:275368
zf-H2C2_2 351..374 CDD:290200
C2H2 Zn finger 367..387 CDD:275368
C2H2 Zn finger 395..415 CDD:275368 7/25 (28%)
C2H2 Zn finger 423..443 CDD:275368 6/19 (32%)
zf-H2C2_2 435..460 CDD:290200 6/29 (21%)
C2H2 Zn finger 451..471 CDD:275368 4/20 (20%)
zf-H2C2_2 463..488 CDD:290200 7/25 (28%)
C2H2 Zn finger 479..499 CDD:275368 6/19 (32%)
zf-H2C2_2 491..514 CDD:290200 4/25 (16%)
C2H2 Zn finger 507..527 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24394
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.