DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip88E and IAR1

DIOPT Version :9

Sequence 1:NP_650440.2 Gene:Zip88E / 41847 FlyBaseID:FBgn0038312 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_564921.1 Gene:IAR1 / 843138 AraportID:AT1G68100 Length:469 Species:Arabidopsis thaliana


Alignment Length:413 Identity:83/413 - (20%)
Similarity:139/413 - (33%) Gaps:151/413 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LVLGLGSLL-FGLLP-AFISERNRRRFPLTASLLLCFGAGILLATALVHILP------------- 82
            |::.|.||: ..||| .|:..:..:.|   ...|..||||.:|..|.:|.||             
plant   116 LLVSLASLICLVLLPIMFVQGKPSKWF---VDSLALFGAGAMLGDAFLHQLPHAFGGGHSHSNDH 177

  Fly    83 -EVREQMDSKFAE--------------VAMCGGFFIIYFIDEFIHYFFGEAIQHTHAHDAETPAT 132
             |..:..|...::              :::..|..:...:::.:.|                   
plant   178 HENHDHHDHSHSDSPSHSHSIQDLSVGLSVLAGIVVFLLVEKLVRY------------------- 223

  Fly   133 EPPRRPTNDNGYGAVDERAPLLSAEPNTSHGHSHHHSH--------DHDHNHPASASGCNDASVE 189
                          |:|.    |:..|| .||.|||.|        :.|||:....|. :||.|.
plant   224 --------------VEEN----SSGSNT-WGHHHHHHHAGSKKLKDEGDHNNLDQQSS-SDAIVN 268

  Fly   190 ----------DANARICHTSHTEPCAQSMTGT-------------------------LGLFVALS 219
                      |.:.|...||.::...:|.:||                         |.|| :..
plant   269 SSEKVSGGSTDKSLRKRKTSASDATDKSDSGTEITSDGKSDKPEQVETRSSSLVFGYLNLF-SDG 332

  Fly   220 LHSAIEGLAIGVQNSSTKVLFLLGAVACHKFVMGFCLGLEFRSNPQ-------------TSFRAQ 271
            :|:..:|:|:|      ....:.|:|......| |.|..|.   ||             |..:|.
plant   333 VHNFTDGMALG------SAFLIYGSVGGWSRTM-FLLAHEL---PQEIGDFGILVRSGFTVTKAL 387

  Fly   272 FVGISVFALGAVIGIGLGMLIVDVPAAWSSKTLPIVQALAGGTLFYVTVCEVIPREKARWHSN-- 334
            |... :.||.|:.|..|.::..:.|...|     :::....|...|:.|..|:    |..:::  
plant   388 FFNF-LSALVALAGTALVLVWGNEPGQSS-----LIEGFTAGGFIYIAVAGVL----AEMNNSGK 442

  Fly   335 STRRWAGFAQFATVLAGFATMCI 357
            ||.:.:.....:.:|.....:||
plant   443 STLKNSACHLISLILGMSVALCI 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip88ENP_650440.2 Zip 26..359 CDD:280666 83/413 (20%)
IAR1NP_564921.1 Zip 105..461 CDD:396884 81/407 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.