DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip88E and ZIP5

DIOPT Version :9

Sequence 1:NP_650440.2 Gene:Zip88E / 41847 FlyBaseID:FBgn0038312 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_172022.1 Gene:ZIP5 / 837029 AraportID:AT1G05300 Length:360 Species:Arabidopsis thaliana


Alignment Length:361 Identity:80/361 - (22%)
Similarity:135/361 - (37%) Gaps:68/361 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AATSRGDLEKVLAMLVLGLGSLLFGLLPAFISERNRRRFPLTASLLL--CFGAGILLATALVHIL 81
            |...:..:..:.::|..|:..::|.||..|.....    |.|....:  .|.||::|||..:|:|
plant    43 AGAKKYKIAAIPSVLAAGVIGVMFPLLGKFFPSLK----PETTFFFVTKAFAAGVILATGFMHVL 103

  Fly    82 PEVREQMDSKFAE-----------VAMCGGFFIIYFIDEFIHYFFGEAIQHTHAHDAETPATEPP 135
            ||..|::.|...:           :||......: .:|.|...:|.:      ||...:......
plant   104 PEGYEKLTSPCLKGEAWEFPFTGFIAMVAAILTL-SVDSFATSYFHK------AHFKTSKRIGDG 161

  Fly   136 RRPTNDNGYGAVDERAPLLSAEPNTSHGHSHHHSHDHDHNHPASASGCNDASVEDANARICHTSH 200
            .......|.|..||..         .|.|:|.|:|             ....||...::: ....
plant   162 EEQDAGGGGGGGDELG---------LHVHAHGHTH-------------GIVGVESGESQV-QLHR 203

  Fly   201 TEPCAQSMTGTLGLFVALSLHSAIEGLAIGVQNSSTKVLFLLGAVACHKFVMGFCLGLEFRSNPQ 265
            |...||.      |.|.:.:||.:.|:::|...|......|..|:..|:...|..||   ....|
plant   204 TRVVAQV------LEVGIIVHSVVIGISLGASQSPDTAKALFAALMFHQCFEGLGLG---GCIAQ 259

  Fly   266 TSFRAQFVGIS--VFALGAVIGIGLGMLIVDVPAAW--SSKTLPIVQ----ALAGGTLFYVTVCE 322
            .:|....:.|.  .|::...:||.:||.|   .:::  ||.|..|||    |.:.|.|.|:::.:
plant   260 GNFNCMSITIMSIFFSVTTPVGIAVGMAI---SSSYDDSSPTALIVQGVLNAASAGILIYMSLVD 321

  Fly   323 VIPREKARWHSNSTRRWAGFAQFATVLAGFATMCII 358
            .:..:.......|..|....|.. ::|.|...|.::
plant   322 FLAADFMHPKMQSNTRLQIMAHI-SLLVGAGVMSLL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip88ENP_650440.2 Zip 26..359 CDD:280666 79/354 (22%)
ZIP5NP_172022.1 zip 33..360 CDD:273287 80/361 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3263
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.