DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip88E and ZIP3

DIOPT Version :9

Sequence 1:NP_650440.2 Gene:Zip88E / 41847 FlyBaseID:FBgn0038312 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_180786.1 Gene:ZIP3 / 817787 AraportID:AT2G32270 Length:339 Species:Arabidopsis thaliana


Alignment Length:331 Identity:79/331 - (23%)
Similarity:119/331 - (35%) Gaps:101/331 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 AATSRGDLEKVLAMLVLGLGSLLFGLL-PAFISERNRRRFPLTASLLL--CFGAGILLATALVHI 80
            |...:..:..:..:|:.|:..:||.|| ..|.|.|     |.|....:  .|.||::|||..:|:
plant    48 AGARKYKIAAIPTVLIAGIIGVLFPLLGKVFPSLR-----PETCFFFVTKAFAAGVILATGFMHV 107

  Fly    81 LPEVREQMDSKFAEVAMCGGFFIIYFIDEFIHYFFGEAIQHTHAHDAETPATEPPRRPTNDNGYG 145
            |||..|.::|.      |               ...||        .|.|.|            |
plant   108 LPEAYEMLNSP------C---------------LTSEA--------WEFPFT------------G 131

  Fly   146 AVDERAPLLSAEPNTSHGHSHHHSHDHDHNHPASASGCNDASVEDANARICHTS----------- 199
            .:...|.:|:...:|....|.:.||...... .|.....::||:....:|..|.           
plant   132 FIAMIAAILTLSVDTFATSSFYKSHCKASKR-VSDGETGESSVDSEKVQILRTRVIAQVLELGII 195

  Fly   200 -HTE------PCAQSMTGTLGLFVALSLHSAIEGLAIGVQNSSTKVLFLLGAVACHKFVMGFCLG 257
             |:.      ..:||......||:||..|...|||.:|            |.:|..||.   ||.
plant   196 VHSVVIGISLGASQSPDAAKALFIALMFHQCFEGLGLG------------GCIAQGKFK---CLS 245

  Fly   258 LEFRSNPQTSFRAQFVGISVFALGAVIGIGLGMLIVDVPAAWSSKTLPIVQ----ALAGGTLFYV 318
            :...|             :.||:...|||.:||.|.: ....||.|..|||    |.:.|.|.|:
plant   246 VTIMS-------------TFFAITTPIGIVVGMGIAN-SYDESSPTALIVQGVLNAASAGILIYM 296

  Fly   319 TVCEVI 324
            ::.:::
plant   297 SLVDLL 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip88ENP_650440.2 Zip 26..359 CDD:280666 78/324 (24%)
ZIP3NP_180786.1 zip 38..339 CDD:273287 79/331 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3263
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.