DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip88E and ZIP7

DIOPT Version :9

Sequence 1:NP_650440.2 Gene:Zip88E / 41847 FlyBaseID:FBgn0038312 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_178488.1 Gene:ZIP7 / 814931 AraportID:AT2G04032 Length:365 Species:Arabidopsis thaliana


Alignment Length:388 Identity:79/388 - (20%)
Similarity:141/388 - (36%) Gaps:97/388 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PTLAATSR-----------GDLE----------KVLAMLVLGLGSLLFGLLPAFISERNRRRFPL 59
            |:||..:.           |||.          |::|:..:.:.|::...||.|     .|..|.
plant    23 PSLAGNAENADVSECKAESGDLSCHNNKEAQKLKIIAIPSILVASMIGVSLPLF-----SRSIPA 82

  Fly    60 ------TASLLLCFGAGILLATALVHILPEVREQMDSK-----------FAEVAMCGGFFIIYFI 107
                  .:.::....:|::|||..:|:||:..:.:.||           ||.........::..|
plant    83 LGPDREMSVIVKTLASGVILATGFMHVLPDSFDDLTSKCLPEDPWQKFPFATFITMISALLVLMI 147

  Fly   108 DEFIHYFFGEAIQHTHAHDAETPATEPPRRPTNDNGYGAVDERAPLLSAEPNTSHGHSHHHSHDH 172
            :.|....:.   :.|...:.|....|        ||..:||.:..:.:.|..:|:.......:  
plant   148 ESFAMCAYA---RRTSKREGEVVPLE--------NGSNSVDTQNDIQTLENGSSYVEKQEKVN-- 199

  Fly   173 DHNHPASASGCNDASVEDANARICHTSHTEPCAQSMTGTLGLFVALSLHSAIEGLAIGVQNSSTK 237
                            ||..:.:.   ..:..||.:  .||:.|    ||.:.|||:|..::...
plant   200 ----------------EDKTSELL---RNKVIAQIL--ELGIVV----HSVVIGLAMGASDNKCT 239

  Fly   238 VLFLLGAVACHKFVMGFCLG-----LEFRSNPQTSFRAQFVGISVFALGAVIGIGLGMLIVDVPA 297
            |..|:.|:..|:...|..||     .:|:|      :..:..:..|::....||.|||.|..:..
plant   240 VQSLIAALCFHQLFEGMGLGGSILQAQFKS------KTNWTMVFFFSVTTPFGIVLGMAIQKIYD 298

  Fly   298 AWSSKTLPIV---QALAGGTLFYVTVCEVIPRE--KARWHSNSTRRWAGFAQFATVLAGFATM 355
            ..|...|.:|   .|.:.|.|.|:.:..::..|  ..:...|......|:....|..||.:.|
plant   299 ETSPTALIVVGVLNACSAGLLIYMALVNLLAHEFFGPKIQGNIKLHVLGYVATFTGAAGMSLM 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip88ENP_650440.2 Zip 26..359 CDD:280666 74/367 (20%)
ZIP7NP_178488.1 Zip 37..365 CDD:412377 76/374 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3263
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981397at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.