DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip88E and Slc39a1

DIOPT Version :9

Sequence 1:NP_650440.2 Gene:Zip88E / 41847 FlyBaseID:FBgn0038312 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001128049.1 Gene:Slc39a1 / 361986 RGDID:1305241 Length:324 Species:Rattus norvegicus


Alignment Length:348 Identity:89/348 - (25%)
Similarity:142/348 - (40%) Gaps:81/348 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KVLAMLVLGLGSLLFGLLPAFISERNRRRFPLTA------SLLLCFGAGILLATALVHILPEVRE 86
            |:.|:::|.|.:|:..|:|..:..|:......:|      ||:.||..|:.|||.|:.:||:...
  Rat    30 KLGALVLLLLLTLICSLVPVCVLRRSGANHEASASGQKALSLVSCFAGGVFLATCLLDLLPDYLA 94

  Fly    87 QMDS-----------KFAEVAMCGGFFIIYFIDEFIHYFFGEAIQHTHAHDAETPATEPPRRPTN 140
            .:|.           ...|..:..|||::..::           |.|.|:..::....|      
  Rat    95 AIDEALEALHVTLQFPLQEFILAMGFFLVLVME-----------QITLAYKEQSSPPHP------ 142

  Fly   141 DNGYGAVDERAPLLSAEPNTSHGHSHHHSHDHDHNHPASASGCNDASVEDANARICHTSHTEPCA 205
                   :|...||    .|.:|...|.   ||......|||                   .|.|
  Rat   143 -------EETRALL----GTVNGGPQHW---HDGPGIPQASG-------------------TPAA 174

  Fly   206 QSMTGTLGLFVALSLHSAIEGLAIGVQNSSTKVLFLLGAVACHKFVMGFCLGLEFRSNPQTSFRA 270
            .|......|..:|:|||..||||:|:|....:.:.|..|:..||.::...|.|...   |:..||
  Rat   175 PSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILAVSLSLRLL---QSHLRA 236

  Fly   271 QFV---GISVFALGAVIGIGLGMLIVDVPAAWSSKTLPIVQALAGGTLFYVTVCEVIPREKARWH 332
            |.|   || :|:....:|||||..:.:...........:::.:|.||..|:|..|::|:|.|   
  Rat   237 QVVAGCGI-LFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAGTFLYITFLEILPQELA--- 297

  Fly   333 SNSTRRWAGFAQFATVLAGFATM 355
             .|.:|   ..:...:|||||.:
  Rat   298 -TSEQR---ILKVILLLAGFALL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip88ENP_650440.2 Zip 26..359 CDD:280666 89/348 (26%)
Slc39a1NP_001128049.1 Zip 48..319 CDD:396884 83/330 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 116 1.000 Domainoid score I5803
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11040
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.