DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip88E and SLC39A3

DIOPT Version :9

Sequence 1:NP_650440.2 Gene:Zip88E / 41847 FlyBaseID:FBgn0038312 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_653165.2 Gene:SLC39A3 / 29985 HGNCID:17128 Length:314 Species:Homo sapiens


Alignment Length:314 Identity:89/314 - (28%)
Similarity:136/314 - (43%) Gaps:50/314 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 KVLAMLVLGLGSLLFGLLPAFISERNRRRFPLTASLL-LC--FGAGILLATALVHILPEVREQM- 88
            |:|.|:.:....||..|||..|.|.:..:...:..:| ||  ||.|:.|||....:||.|||:: 
Human     8 KILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKLQ 72

  Fly    89 ----------DSKFAEVAMCGGFFIIYFIDEFIHYFFGEAIQHTHAHDAETPATEPPRRPTNDNG 143
                      |...||..:..|||:..|:::.|..|..|.....   |.||      ....:|.|
Human    73 KVLSLGHISTDYPLAETILLLGFFMTVFLEQLILTFRKEKPSFI---DLET------FNAGSDVG 128

  Fly   144 YGAVDERAPLLSAEPNTSHGHSHHHSHDHDHNHPASASGCNDASVEDANARICHTSHTEPCAQSM 208
            ..: :..:|.:..    :.||: .:...|.|....|..|.:.||    ..|:             
Human   129 SDS-EYESPFMGG----ARGHA-LYVEPHGHGPSLSVQGLSRAS----PVRL------------- 170

  Fly   209 TGTLGLFVALSLHSAIEGLAIGVQNSSTKVLFLLGAVACHKFVMGFCLGLEFRSNPQTSFRAQFV 273
               |.|..|||.||..||||:|:|....||:.|...||.|:.::...||:....:......|..:
Human   171 ---LSLAFALSAHSVFEGLALGLQEEGEKVVSLFVGVAVHETLVAVALGISMARSAMPLRDAAKL 232

  Fly   274 GISVFALGAVIGIGLGMLIVDVPAAWSSKTLPIVQALAGGTLFYVTVCEVIPRE 327
            .::|.|: ..:|||||:.|........|....::|.|||||..::|..|::.:|
Human   233 AVTVSAM-IPLGIGLGLGIESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKE 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip88ENP_650440.2 Zip 26..359 CDD:280666 89/314 (28%)
SLC39A3NP_653165.2 Zip 5..309 CDD:396884 89/314 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6210
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5411
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.