DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip88E and Slc39a8

DIOPT Version :9

Sequence 1:NP_650440.2 Gene:Zip88E / 41847 FlyBaseID:FBgn0038312 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001011952.1 Gene:Slc39a8 / 295455 RGDID:1308236 Length:462 Species:Rattus norvegicus


Alignment Length:366 Identity:88/366 - (24%)
Similarity:151/366 - (41%) Gaps:72/366 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LAMLVLGLGSLLFGLLPAFISERNRRRFPLTASLLLCFGAGILLATALVHILPEV---REQMDSK 91
            |::.::.|.|||..:|...|   .:..||...:..:....|.|.:.|:..::||.   ..::|: 
  Rat   134 LSVTIINLASLLGLILTPLI---KKSYFPKILTYFVGLAIGTLFSNAIFQLIPEAFGFNPKIDN- 194

  Fly    92 FAE--VAMCGGFFIIYFIDEFIHYFFGEAIQHTHAH------DAETPATEP---PRRPTNDNGYG 145
            :.|  ||:.|||::::|::..:........|:.|.|      .::..|.:|   |..|.|    |
  Rat   195 YVEKAVAVFGGFYMLFFVERTLKMLLKTYGQNDHTHFRNDDFGSKEKAHQPKTLPLPPVN----G 255

  Fly   146 AVDERAPLLSAEPNTSHGHSHHHSHDHDHNHPASASGCNDASVEDANARICHTSHTEPCAQSMTG 210
            ......|.:: |||   ||.|..:             .:..|::|..|.....:..:....|..|
  Rat   256 VTCYANPAVT-EPN---GHIHFDT-------------VSVVSLQDGKAESSSCTCLKGPKLSEIG 303

  Fly   211 TLGLFVAL--SLHSAIEGLAIG-------VQNSSTKVLFLLGAVACHKF---VMGFCLGLEFRSN 263
            |:...:.|  :||:.|:|||||       :|..||.:     |:.|.:|   :..|.:.|    |
  Rat   304 TIAWMITLCDALHNFIDGLAIGASYTLSLLQGLSTSI-----AILCEEFPHELGDFVILL----N 359

  Fly   264 PQTSFRAQFVGISVFALGAVIGIGLGMLIVDVPAAWSSKTLP-IVQALAGGTLFYVTVCEVIPRE 327
            ...|.|...:...:.|....:|:..|:|:       .:...| |:.|||||...|:::.::.|..
  Rat   360 AGMSTRQALLFNFLSACSCYVGLAFGILV-------GNNFAPNIIFALAGGMFLYISLADMFPEM 417

  Fly   328 KARWHSNSTRRWAGFAQF----ATVLAGFATMCIINFYLSD 364
            ........|.|...|..|    |.:|.||..:.:|..|..|
  Rat   418 NDMLREKVTGRQTDFTFFMIQNAGMLTGFTAILLITLYAGD 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip88ENP_650440.2 Zip 26..359 CDD:280666 85/359 (24%)
Slc39a8NP_001011952.1 Zip 126..453 CDD:396884 85/359 (24%)
XEXPHE-motif. /evidence=ECO:0000250|UniProtKB:Q9C0K1 345..350 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.