DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip88E and Slc39a2

DIOPT Version :9

Sequence 1:NP_650440.2 Gene:Zip88E / 41847 FlyBaseID:FBgn0038312 Length:366 Species:Drosophila melanogaster
Sequence 2:NP_001034765.2 Gene:Slc39a2 / 214922 MGIID:2684326 Length:309 Species:Mus musculus


Alignment Length:374 Identity:96/374 - (25%)
Similarity:144/374 - (38%) Gaps:124/374 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 VLAMLVLGLGSLLFGLLPAFISERNRRRFPLTA---------SLLLCFGAGILLATALVHILPEV 84
            :||:|||.||.   ||.|.::     :.|.:.|         |||.|..||:.|...|:|:..|.
Mouse    12 LLALLVLTLGC---GLTPIYV-----KWFQMDAATGHHHRVLSLLGCTSAGVFLGAGLMHMTAEA 68

  Fly    85 REQMDS---KFAEVAMCG-------------------------GFFIIYFIDEFIHYFFGEAIQH 121
            .|.::|   ||.|....|                         |||.::.::..       |:|.
Mouse    69 LEGIESEIQKFVEQNSTGSKGNSSRDAASSYVEYPYGELVISLGFFFVFLLESL-------ALQC 126

  Fly   122 THAHDAETPATEPPRRPTNDNGYGAVDERAPLLSAEPNTSHGHSHHHSHDHDHNHPASASGCNDA 186
            .|.....:...|.....|:..|:                             |.|||..|.    
Mouse   127 CHGAAGGSTVQEEEWGGTHAFGF-----------------------------HKHPAVPSP---- 158

  Fly   187 SVEDANARICHTSHTEPCAQSMTGTLGLFVALSLHSAIEGLAIGVQNSSTKVLFLLGAVACHKFV 251
                              ::.....|.|.::||.||..||||:|:|.:....:.|..||..||.:
Mouse   159 ------------------SRGPLRALVLLLSLSFHSVFEGLAVGLQATVAATIQLCVAVLAHKGL 205

  Fly   252 MGFCLGL---EFRSNPQTSFRAQFVGISVFALGAVIGIGLGMLIVDVPAAWSSKTLPIVQA---- 309
            :.|.:||   :..:.|:.   |.|..:|: ||.:.:|:.||:   .|....|.:|..:.||    
Mouse   206 VVFSVGLRLGKIGTGPRW---ATFCILSL-ALMSPVGLALGL---TVAGGASGQTQGLAQAVLEG 263

  Fly   310 LAGGTLFYVTVCEVIPREKARWHSNSTRRWAGFAQFATVLAGFATMCII 358
            :|.||..|||..|::|||.|...       |..|:::.|.||||.|.:|
Mouse   264 IAAGTFLYVTFLEILPRELACPE-------APLAKYSCVAAGFAFMALI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip88ENP_650440.2 Zip 26..359 CDD:280666 96/374 (26%)
Slc39a2NP_001034765.2 Zip 5..306 CDD:280666 96/374 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5998
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11040
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.