DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Zip88E and Slc39a3

DIOPT Version :9

Sequence 1:NP_650440.2 Gene:Zip88E / 41847 FlyBaseID:FBgn0038312 Length:366 Species:Drosophila melanogaster
Sequence 2:XP_006513090.1 Gene:Slc39a3 / 106947 MGIID:2147269 Length:348 Species:Mus musculus


Alignment Length:343 Identity:95/343 - (27%)
Similarity:144/343 - (41%) Gaps:76/343 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PSPTLAAT-SRGDLEKVLAMLVLGLGSLLFGLLPAFISERNRRRFPLTASLL-LC--FGAGILLA 74
            |..||||| ::..:.|||.|:.:....||..|||..:.|.:..:...:..:| ||  ||.|:.||
Mouse    24 PCVTLAATMTKLLVAKVLCMVGVFFFMLLGSLLPVKVIEADLEKAHRSKKVLSLCNTFGGGVFLA 88

  Fly    75 TALVHILPEVREQM-----------DSKFAEVAMCGGFFIIYFIDEFIHYFFGEAIQHTHAHDAE 128
            |....:||.||:::           |...||..|..|||:..|:::.:..|              
Mouse    89 TCFNALLPAVRDKLQQVLSLGHISTDYPLAETLMMVGFFLTVFVEQLVLTF-------------- 139

  Fly   129 TPATEPPRRPTNDNGYGAVDERAPLLSAEPNTSHGHSHHHSHDHDHNHPASASGCNDASVEDANA 193
                   ||           ||.|.:..|  |.:..|...| |.::..|....|...        
Mouse   140 -------RR-----------ERPPFIDLE--TFNAGSDAGS-DSEYESPFVGVGNRS-------- 175

  Fly   194 RICHTSHTEPCAQSMTG--------------TLGLFVALSLHSAIEGLAIGVQNSSTKVLFLLGA 244
               |:.:.||.|.:...              .|.|..|||.||..||||:|:|....:|:.|...
Mouse   176 ---HSLYPEPTAHTHGAGLRLRELGRPGPLRLLSLVFALSAHSVFEGLALGLQEEGERVVSLFVG 237

  Fly   245 VACHKFVMGFCLGLEFRSNPQTSFRAQFVGISVFALGAVIGIGLGMLIVDVPAAWSSKTLPIVQA 309
            ||.|:.::...||:....:......|..:.::|.|: ..:|||||:.|....:..||....::|.
Mouse   238 VAIHETLVAVALGISMARSAVPLRDAAKLAVTVSAM-IPVGIGLGLGIESARSVASSVASALLQG 301

  Fly   310 LAGGTLFYVTVCEVIPRE 327
            |||||..:||..|::.:|
Mouse   302 LAGGTFLFVTFLEILAKE 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Zip88ENP_650440.2 Zip 26..359 CDD:280666 89/330 (27%)
Slc39a3XP_006513090.1 Zip 36..343 CDD:308248 89/331 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5998
eggNOG 1 0.900 - - E1_KOG1558
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6210
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D471714at33208
OrthoFinder 1 1.000 - - FOG0000574
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5411
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.760

Return to query results.
Submit another query.