DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynO and atpH

DIOPT Version :9

Sequence 1:NP_524358.2 Gene:ATPsynO / 41845 FlyBaseID:FBgn0016691 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_418191.1 Gene:atpH / 948254 ECOCYCID:EG10105 Length:177 Species:Escherichia coli


Alignment Length:172 Identity:38/172 - (22%)
Similarity:88/172 - (51%) Gaps:5/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YATALYSAASKLSQLDQVEKDLTALQATIRSDKKLREYVTSPIINKKVMATALKEASEKLRFAPA 100
            ||.|.:..|.:...:::.: |:.|..|.:..::::.|.::..:..:.:..:.:....|:|  ...
E. coli    11 YAKAAFDFAVEHQSVERWQ-DMLAFAAEVTKNEQMAELLSGALAPETLAESFIAVCGEQL--DEN 72

  Fly   101 TVNLLGLLADNGRLKKLDTVINAYKTIMAAHRGEVVCEVVTAKPLDASQSKQLEGALKSFLKGNE 165
            ..||:.::|:||||..|..|:..:..:.|........:|::|..|...|..::..|::..|  :.
E. coli    73 GQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQQLAKISAAMEKRL--SR 135

  Fly   166 SLKITSRVDPSIIGGLIVSIGDKYVDMSIATKVKLYTDVIQT 207
            .:|:..::|.|::.|:|:..||..:|.|:..:::...||:|:
E. coli   136 KVKLNCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLADVLQS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynONP_524358.2 OSCP 32..199 CDD:278635 35/162 (22%)
atpHNP_418191.1 PRK05758 1..177 CDD:235593 37/170 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I622
eggNOG 1 0.900 - - E1_COG0712
Hieranoid 1 1.000 - -
Inparanoid 1 1.050 62 1.000 Inparanoid score I424
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004090
OrthoInspector 1 1.000 - - oto111700
orthoMCL 1 0.900 - - OOG6_101031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.