DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynO and ATPD

DIOPT Version :9

Sequence 1:NP_524358.2 Gene:ATPsynO / 41845 FlyBaseID:FBgn0016691 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_192703.1 Gene:ATPD / 826551 AraportID:AT4G09650 Length:234 Species:Arabidopsis thaliana


Alignment Length:167 Identity:33/167 - (19%)
Similarity:77/167 - (46%) Gaps:5/167 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YATALYSAASKLSQLDQVEKDLTALQATIRSDKKLREYVTSPIINKKVMATALKEASEKLRFAPA 100
            ||.||...|.:...::....|:..|: .:.||.::..:..:|.|..:.....:.:..:.......
plant    55 YAMALADVAKRNDTMELTVTDIEKLE-QVFSDPQVLNFFANPTITVEKKRQVIDDIVKSSSLQSH 118

  Fly   101 TVNLLGLLADNGRLKKLDTVINAYKTIMAAHRGEVVCEVVTAKPLDASQSKQLEGALKSFLKGNE 165
            |.|.|.:|.|..|:..:..::..::.:........:.||.:...|:|.|..|:...::. |.|.:
plant   119 TSNFLNVLVDANRINIVTEIVKEFELVYNKLTDTQLAEVRSVVKLEAPQLAQIAKQVQK-LTGAK 182

  Fly   166 SLKITSRVDPSIIGGLIVSIGD---KYVDMSIATKVK 199
            ::::.:.:|.|::.|..:..|:   |.:|||:..:::
plant   183 NVRVKTVIDASLVAGFTIRYGESGSKLIDMSVKKQLE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynONP_524358.2 OSCP 32..199 CDD:278635 33/165 (20%)
ATPDNP_192703.1 OSCP 52..225 CDD:395158 33/167 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0712
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.670

Return to query results.
Submit another query.