DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynO and atp5po

DIOPT Version :9

Sequence 1:NP_524358.2 Gene:ATPsynO / 41845 FlyBaseID:FBgn0016691 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001037877.1 Gene:atp5po / 733460 XenbaseID:XB-GENE-957388 Length:211 Species:Xenopus tropicalis


Alignment Length:209 Identity:94/209 - (44%)
Similarity:143/209 - (68%) Gaps:4/209 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASINKLALLSRTLSSAAAQ---ATVKPPVQVFGLEGRYATALYSAASKLSQLDQVEKDLTALQA 62
            ||::...::..|:.|::|.:   ..||||:||:||||||||||||||:|..:||||||:||.:.|
 Frog     1 MAALGSFSVKVRSFSTSAVRPISKLVKPPIQVYGLEGRYATALYSAATKQKKLDQVEKELTRISA 65

  Fly    63 TIRSDKKLREYVTSPIINKKVMATALKEASEKLRFAPATVNLLGLLADNGRLKKLDTVINAYKTI 127
            .|: |.||...:|:|.:.:.:....:.:...|.:.:|.|||.:.|||:||||.:...||:::..|
 Frog    66 LIK-DPKLSGVITNPHVKRALKQKTVGDIMAKEKLSPLTVNFVNLLAENGRLSQASDVISSFAKI 129

  Fly   128 MAAHRGEVVCEVVTAKPLDASQSKQLEGALKSFLKGNESLKITSRVDPSIIGGLIVSIGDKYVDM 192
            |:||||||:|.|.||.|||.:...:|:.||..||...|:||:.::.|.:|:||:|||:||||:||
 Frog   130 MSAHRGEVLCSVTTASPLDEANLTELKSALNGFLAKGETLKLETKTDATILGGMIVSVGDKYIDM 194

  Fly   193 SIATKVKLYTDVIQ 206
            |...|::..|.:::
 Frog   195 STKAKIQKLTKIMR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynONP_524358.2 OSCP 32..199 CDD:278635 81/166 (49%)
atp5poNP_001037877.1 OSCP 35..207 CDD:365949 82/172 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I3987
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1283
Inparanoid 1 1.050 186 1.000 Inparanoid score I3803
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1178688at2759
OrthoFinder 1 1.000 - - FOG0004090
OrthoInspector 1 1.000 - - oto102831
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3931
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.