DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynO and ATP5PO

DIOPT Version :9

Sequence 1:NP_524358.2 Gene:ATPsynO / 41845 FlyBaseID:FBgn0016691 Length:209 Species:Drosophila melanogaster
Sequence 2:NP_001688.1 Gene:ATP5PO / 539 HGNCID:850 Length:213 Species:Homo sapiens


Alignment Length:177 Identity:87/177 - (49%)
Similarity:127/177 - (71%) Gaps:1/177 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VKPPVQVFGLEGRYATALYSAASKLSQLDQVEKDLTALQATIRSDKKLREYVTSPIINKKVMATA 87
            |:|||||:|:||||||||||||||.::|:||||:|..: |.|..:.|:...|.:|.:.:.:...:
Human    28 VRPPVQVYGIEGRYATALYSAASKQNKLEQVEKELLRV-AQILKEPKVAASVLNPYVKRSIKVKS 91

  Fly    88 LKEASEKLRFAPATVNLLGLLADNGRLKKLDTVINAYKTIMAAHRGEVVCEVVTAKPLDASQSKQ 152
            |.:.:.|.||:|.|.||:.|||:||||.....|::|:.|:|:.|||||.|.|.:|.||:.:...:
Human    92 LNDITAKERFSPLTTNLINLLAENGRLSNTQGVVSAFSTMMSVHRGEVPCTVTSASPLEEATLSE 156

  Fly   153 LEGALKSFLKGNESLKITSRVDPSIIGGLIVSIGDKYVDMSIATKVK 199
            |:..|||||...:.||:.::.||||:||:||.||:||||||:.||::
Human   157 LKTVLKSFLSQGQVLKLEAKTDPSILGGMIVRIGEKYVDMSVKTKIQ 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynONP_524358.2 OSCP 32..199 CDD:278635 80/166 (48%)
ATP5PONP_001688.1 OSCP 37..209 CDD:365949 80/168 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160356
Domainoid 1 1.000 161 1.000 Domainoid score I4024
eggNOG 1 0.900 - - E1_COG0712
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1283
Inparanoid 1 1.050 178 1.000 Inparanoid score I4034
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57719
OrthoDB 1 1.010 - - D1178688at2759
OrthoFinder 1 1.000 - - FOG0004090
OrthoInspector 1 1.000 - - oto88963
orthoMCL 1 0.900 - - OOG6_101031
Panther 1 1.100 - - LDO PTHR11910
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R121
SonicParanoid 1 1.000 - - X3931
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.